Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein U

Gene

Cenpu

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Plays an important role in the correct PLK1 localization to the mitotic kinetochores. A scaffold protein responsible for the initial recruitment and maintenance of the kinetochore PLK1 population until its degradation. Involved in transcriptional repression (By similarity).By similarity

GO - Biological processi

  • chordate embryonic development Source: MGI
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-2467813. Separation of Sister Chromatids.
R-MMU-2500257. Resolution of Sister Chromatid Cohesion.
R-MMU-5663220. RHO GTPases Activate Formins.
R-MMU-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-MMU-68877. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein U
Short name:
CENP-U
Alternative name(s):
MLF1-interacting protein
Gene namesi
Name:Cenpu
Synonyms:Mlf1ip
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1919126. Cenpu.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity
  • Chromosomecentromerekinetochore By similarity

  • Note: Localizes in the kinetochore domain of centromeres. Colocalizes with PLK1 at the interzone between the inner and the outer kinetochore plates (By similarity).By similarity

GO - Cellular componenti

  • condensed chromosome kinetochore Source: UniProtKB-SubCell
  • cytoplasm Source: MGI
  • microtubule organizing center Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Kinetochore, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 410410Centromere protein UPRO_0000247673Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei74 – 741Phosphothreonine; by PLK1By similarity
Modified residuei106 – 1061PhosphoserineCombined sources
Modified residuei111 – 1111PhosphoserineCombined sources
Modified residuei115 – 1151PhosphoserineCombined sources
Modified residuei131 – 1311PhosphoserineBy similarity
Modified residuei134 – 1341PhosphoserineBy similarity
Modified residuei136 – 1361PhosphoserineBy similarity
Modified residuei182 – 1821PhosphoserineCombined sources
Modified residuei186 – 1861PhosphoserineCombined sources
Modified residuei191 – 1911PhosphothreonineCombined sources
Modified residuei224 – 2241PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated by PLK1 at Thr-74, creating a self-tethering site that specifically interacts with the polo-box domain of PLK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8C4M7.
PaxDbiQ8C4M7.
PeptideAtlasiQ8C4M7.
PRIDEiQ8C4M7.

PTM databases

iPTMnetiQ8C4M7.
PhosphoSiteiQ8C4M7.

Expressioni

Tissue specificityi

Testis, spleen, heart, kidney, liver, lung, brain and CFU-E erythroid precursor cells.1 Publication

Developmental stagei

Expressed at different stages of development between embryonic days 7-17 (E7-E17) and highest expression seen at E11. Detected in the liver at E13.5 and strongly expressed in the cephalic mesenchyme and roof of the hindbrain, lining of the pericardial cavity and atrial chamber of the heart and lumen of the stomach in 11.5-day embryos.1 Publication

Gene expression databases

BgeeiENSMUSG00000031629.
CleanExiMM_MLF1IP.
ExpressionAtlasiQ8C4M7. baseline and differential.
GenevisibleiQ8C4M7. MM.

Interactioni

Subunit structurei

Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts with MLF1 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034045.

Structurei

3D structure databases

ProteinModelPortaliQ8C4M7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili291 – 35262Sequence analysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi4 – 2118Nuclear localization signalSequence analysisAdd
BLAST
Motifi295 – 31218Nuclear localization signalSequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi58 – 625Poly-Glu

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J00R. Eukaryota.
ENOG410Z48V. LUCA.
GeneTreeiENSGT00390000015511.
HOGENOMiHOG000236255.
HOVERGENiHBG081090.
InParanoidiQ8C4M7.
KOiK11513.
OMAiKQLHQDY.
OrthoDBiEOG091G09Q1.
PhylomeDBiQ8C4M7.
TreeFamiTF330780.

Family and domain databases

InterProiIPR025214. CENP-U.
[Graphical view]
PfamiPF13097. CENP-U. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q8C4M7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAARRSLRYS GNPGAKHSKN TLRSTYSRKQ KAGPKPRPKD VFDFSNNSDA
60 70 80 90 100
SSIPGALEEE EETYETFDPP LHSTAIYAED ELSKHCVSSS SLATHRGKAS
110 120 130 140 150
RNLDPSEDEA SGNESIKVST KKPRRKLEPI SGESDSSADD VRRRVASAEG
160 170 180 190 200
PRSQQRQAAP AAPSPPERPA EPVTPRRTRL HSAQLSPVDE TPATQSQLKT
210 220 230 240 250
QKKVRPSPGR RKRPRRGHTD TDGSESMHIW CLEGKRQSDI TELDVILSVF
260 270 280 290 300
EKTFLEYKQR VESESCNQAI NKFYFKMKGE LIRMLKEAQM LKALKMKNTK
310 320 330 340 350
IIANMEKKRQ RLIEVQDELI RLEPQLKQLQ TKYDDLKERK SSLKKSKHFL
360 370 380 390 400
SNLKQLCQDY SNVQEKGPKG TGKYDSSSLP ALLFKARSIL GAENHLRTIN
410
YQLGKLLELD
Length:410
Mass (Da):46,370
Last modified:July 25, 2006 - v2
Checksum:iF2E8677FB373F75D
GO
Isoform 2 (identifier: Q8C4M7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-48: AKHSKNTLRSTYSRKQKAGPKPRPKDVFDFSNNS → PPSAQYGYLRRRRAVQTLCVLQFPGHPQREGEQK
     49-198: Missing.

Show »
Length:260
Mass (Da):30,268
Checksum:iB287F45F991A518A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti327 – 3271K → E in BAC38300 (PubMed:15116101).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei15 – 4834AKHSK…FSNNS → PPSAQYGYLRRRRAVQTLCV LQFPGHPQREGEQK in isoform 2. 1 PublicationVSP_020031Add
BLAST
Alternative sequencei49 – 198150Missing in isoform 2. 1 PublicationVSP_020032Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY366362 mRNA. Translation: AAR13082.1.
AK006479 mRNA. Translation: BAB24609.1.
AK050386 mRNA. Translation: BAC34227.1.
AK081703 mRNA. Translation: BAC38300.1.
CCDSiCCDS22292.1. [Q8C4M7-1]
RefSeqiNP_082249.1. NM_027973.3. [Q8C4M7-1]
UniGeneiMm.217385.
Mm.22108.

Genome annotation databases

EnsembliENSMUST00000034045; ENSMUSP00000034045; ENSMUSG00000031629. [Q8C4M7-1]
ENSMUST00000093518; ENSMUSP00000091239; ENSMUSG00000031629. [Q8C4M7-2]
GeneIDi71876.
KEGGimmu:71876.
UCSCiuc009lqg.1. mouse. [Q8C4M7-1]
uc009lqh.1. mouse. [Q8C4M7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY366362 mRNA. Translation: AAR13082.1.
AK006479 mRNA. Translation: BAB24609.1.
AK050386 mRNA. Translation: BAC34227.1.
AK081703 mRNA. Translation: BAC38300.1.
CCDSiCCDS22292.1. [Q8C4M7-1]
RefSeqiNP_082249.1. NM_027973.3. [Q8C4M7-1]
UniGeneiMm.217385.
Mm.22108.

3D structure databases

ProteinModelPortaliQ8C4M7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034045.

PTM databases

iPTMnetiQ8C4M7.
PhosphoSiteiQ8C4M7.

Proteomic databases

MaxQBiQ8C4M7.
PaxDbiQ8C4M7.
PeptideAtlasiQ8C4M7.
PRIDEiQ8C4M7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034045; ENSMUSP00000034045; ENSMUSG00000031629. [Q8C4M7-1]
ENSMUST00000093518; ENSMUSP00000091239; ENSMUSG00000031629. [Q8C4M7-2]
GeneIDi71876.
KEGGimmu:71876.
UCSCiuc009lqg.1. mouse. [Q8C4M7-1]
uc009lqh.1. mouse. [Q8C4M7-2]

Organism-specific databases

CTDi79682.
MGIiMGI:1919126. Cenpu.

Phylogenomic databases

eggNOGiENOG410J00R. Eukaryota.
ENOG410Z48V. LUCA.
GeneTreeiENSGT00390000015511.
HOGENOMiHOG000236255.
HOVERGENiHBG081090.
InParanoidiQ8C4M7.
KOiK11513.
OMAiKQLHQDY.
OrthoDBiEOG091G09Q1.
PhylomeDBiQ8C4M7.
TreeFamiTF330780.

Enzyme and pathway databases

ReactomeiR-MMU-2467813. Separation of Sister Chromatids.
R-MMU-2500257. Resolution of Sister Chromatid Cohesion.
R-MMU-5663220. RHO GTPases Activate Formins.
R-MMU-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-MMU-68877. Mitotic Prometaphase.

Miscellaneous databases

PROiQ8C4M7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031629.
CleanExiMM_MLF1IP.
ExpressionAtlasiQ8C4M7. baseline and differential.
GenevisibleiQ8C4M7. MM.

Family and domain databases

InterProiIPR025214. CENP-U.
[Graphical view]
PfamiPF13097. CENP-U. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCENPU_MOUSE
AccessioniPrimary (citable) accession number: Q8C4M7
Secondary accession number(s): Q6UNA2, Q9D9U1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: July 25, 2006
Last modified: September 7, 2016
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.