Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8C310

- ROBO4_MOUSE

UniProt

Q8C310 - ROBO4_MOUSE

Protein

Roundabout homolog 4

Gene

Robo4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 2 (21 Jun 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for Slit proteins, at least for SLIT2, and seems to be involved in angiogenesis and vascular patterning. May mediate the inhibition of primary endothelial cell migration by Slit proteins.1 Publication

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. receptor activity Source: MGI

    GO - Biological processi

    1. angiogenesis Source: UniProtKB-KW
    2. cell differentiation Source: UniProtKB-KW
    3. negative regulation of cell migration Source: MGI

    Keywords - Molecular functioni

    Developmental protein, Receptor

    Keywords - Biological processi

    Angiogenesis, Differentiation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Roundabout homolog 4
    Gene namesi
    Name:Robo4
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 9

    Organism-specific databases

    MGIiMGI:1921394. Robo4.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: MGI
    2. integral component of membrane Source: MGI

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2727Sequence AnalysisAdd
    BLAST
    Chaini28 – 1012985Roundabout homolog 4PRO_0000031041Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi53 ↔ 115PROSITE-ProRule annotation
    Disulfide bondi159 ↔ 208PROSITE-ProRule annotation
    Glycosylationi201 – 2011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi247 – 2471N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi361 – 3611N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi390 – 3901N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi397 – 3971N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi681 – 6811N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi713 – 7131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi762 – 7621N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi783 – 7831N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ8C310.
    PRIDEiQ8C310.

    PTM databases

    PhosphoSiteiQ8C310.

    Expressioni

    Tissue specificityi

    Expressed specifically in embryo and adult vascular endothelium.1 Publication

    Developmental stagei

    In embryonic development of vascular endothelium shows a dynamic expression pattern within vessels, with expression starting in the larger axial vessels and intersomitic vessels at earlier ages, and changing to intersomitic vessel and capillary expression at later stages. At E9.0, is expressed in the central vessels, the dorsal aorta, and intersomitic vessels. At E9.5, is highly expressed in intersomitic vessels with little expression remaining in dorsal aortae. By E10.0, is detected in capillary vessels, the capillary plexus of the limb buds, and throughout the endothelium as microvessels sprout from the dorsal aortae. No expression was detected in the neural tube at E9.0 and E9.5. However, it is detected within the capillaries sprouting into the neural tube, as well as in the adjacent perineural capillary plexus at E10.0.1 Publication

    Gene expression databases

    ArrayExpressiQ8C310.
    BgeeiQ8C310.
    CleanExiMM_ROBO4.
    GenevestigatoriQ8C310.

    Interactioni

    Subunit structurei

    Interacts with SLIT2 and ENAH.1 Publication

    Protein-protein interaction databases

    BioGridi216523. 1 interaction.
    STRINGi10090.ENSMUSP00000110698.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8C310.
    SMRiQ8C310. Positions 8-441.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini32 – 132101Ig-like C2-type 1Add
    BLAST
    Domaini138 – 22588Ig-like C2-type 2Add
    BLAST
    Domaini249 – 34698Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini348 – 44396Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. ROBO family.Curated
    Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG325715.
    GeneTreeiENSGT00750000117765.
    HOGENOMiHOG000074193.
    HOVERGENiHBG061836.
    KOiK06784.
    PhylomeDBiQ8C310.
    TreeFamiTF351053.

    Family and domain databases

    Gene3Di2.60.40.10. 4 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    [Graphical view]
    PfamiPF00041. fn3. 1 hit.
    PF07679. I-set. 1 hit.
    [Graphical view]
    SMARTiSM00060. FN3. 2 hits.
    SM00409. IG. 1 hit.
    SM00408. IGc2. 1 hit.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 1 hit.
    PROSITEiPS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8C310-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSGGTGLLG TEWPLPLLLL FIMGGEALDS PPQILVHPQD QLLQGSGPAK     50
    MRCRSSGQPP PTIRWLLNGQ PLSMATPDLH YLLPDGTLLL HRPSVQGRPQ 100
    DDQNILSAIL GVYTCEASNR LGTAVSRGAR LSVAVLQEDF QIQPRDTVAV 150
    VGESLVLECG PPWGYPKPSV SWWKDGKPLV LQPGRRTVSG DSLMVSRAEK 200
    NDSGTYMCMA TNNAGQRESR AARVSIQESQ DHKEHLELLA VRIQLENVTL 250
    LNPEPVKGPK PGPSVWLSWK VSGPAAPAES YTALFRTQRS PRDQGSPWTE 300
    VLLRGLQSAK LGGLHWGQDY EFKVRPSSGR ARGPDSNVLL LRLPEQVPSA 350
    PPQGVTLRSG NGSVFVSWAP PPAESHNGVI RGYQVWSLGN ASLPAANWTV 400
    VGEQTQLEIA TRLPGSYCVQ VAAVTGAGAG ELSTPVCLLL EQAMEQSARD 450
    PRKHVPWTLE QLRATLRRPE VIASSAVLLW LLLLGITVCI YRRRKAGVHL 500
    GPGLYRYTSE DAILKHRMDH SDSPWLADTW RSTSGSRDLS SSSSLSSRLG 550
    LDPRDPLEGR RSLISWDPRS PGVPLLPDTS TFYGSLIAEQ PSSPPVRPSP 600
    KTPAARRFPS KLAGTSSPWA SSDSLCSRRG LCSPRMSLTP TEAWKAKKKQ 650
    ELHQANSSPL LRGSHPMEIW AWELGSRASK NLSQSPGPNS GSPGEAPRAV 700
    VSWRAVGPQL HRNSSELASR PLPPTPLSLR GASSHDPQSQ CVEKLQAPSS 750
    DPLPAAPLSV LNSSRPSSPQ ASFLSCPSPS SSNLSSSSLS SLEEEEDQDS 800
    VLTPEEVALC LELSDGEETP TNSVSPMPRA PSPPTTYGYI SIPTCSGLAD 850
    MGRAGGGVGS EVGNLLYPPR PCPTPTPSEG SLANGWGSAS EDNVPSARAS 900
    LVSSSDGSFL ADTHFARALA VAVDSFGLSL DPREADCVFT DASSPPSPRG 950
    DLSLTRSFSL PLWEWRPDWL EDAEISHTQR LGRGLPPWPP DSRASSQRSW 1000
    LTGAVPKAGD SS 1012
    Length:1,012
    Mass (Da):108,499
    Last modified:June 21, 2004 - v2
    Checksum:i9116352CAE767CC1
    GO
    Isoform 2 (identifier: Q8C310-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         688-694: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,005
    Mass (Da):107,903
    Checksum:i95F8C43EE184E21E
    GO
    Isoform 3 (identifier: Q8C310-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         440-440: L → LGEGKALSISSTPPPCRPSVSQFLSYIFSSSLSCLLVPLTVPLALPLSSTSQT
         688-694: Missing.

    Show »
    Length:1,057
    Mass (Da):113,251
    Checksum:iBDC167380727CBF7
    GO

    Sequence cautioni

    Isoform 3 : The sequence BAC39850.1 differs from that shown. Reason: Frameshift at positions 916 and 919.
    The sequence AAH20129.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB23506.2 differs from that shown. Reason: Erroneous initiation.
    Isoform 2 : The sequence BAB23506.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    Isoform 2 : The sequence AAH20129.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    Isoform 3 : The sequence BAC39850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei440 – 4401L → LGEGKALSISSTPPPCRPSV SQFLSYIFSSSLSCLLVPLT VPLALPLSSTSQT in isoform 3. 1 PublicationVSP_010663
    Alternative sequencei688 – 6947Missing in isoform 2 and isoform 3. 2 PublicationsVSP_010662

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF536772 mRNA. Translation: AAQ10749.1.
    AK004723 mRNA. Translation: BAB23506.2. Different initiation.
    AK087355 mRNA. Translation: BAC39850.1. Sequence problems.
    BC020129 mRNA. Translation: AAH20129.1. Different initiation.
    RefSeqiNP_083059.2. NM_028783.2.
    UniGeneiMm.485070.

    Genome annotation databases

    EnsembliENSMUST00000102895; ENSMUSP00000099959; ENSMUSG00000032125.
    GeneIDi74144.
    KEGGimmu:74144.
    UCSCiuc009ous.1. mouse. [Q8C310-2]
    uc012gqy.1. mouse. [Q8C310-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF536772 mRNA. Translation: AAQ10749.1 .
    AK004723 mRNA. Translation: BAB23506.2 . Different initiation.
    AK087355 mRNA. Translation: BAC39850.1 . Sequence problems.
    BC020129 mRNA. Translation: AAH20129.1 . Different initiation.
    RefSeqi NP_083059.2. NM_028783.2.
    UniGenei Mm.485070.

    3D structure databases

    ProteinModelPortali Q8C310.
    SMRi Q8C310. Positions 8-441.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 216523. 1 interaction.
    STRINGi 10090.ENSMUSP00000110698.

    PTM databases

    PhosphoSitei Q8C310.

    Proteomic databases

    PaxDbi Q8C310.
    PRIDEi Q8C310.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000102895 ; ENSMUSP00000099959 ; ENSMUSG00000032125 .
    GeneIDi 74144.
    KEGGi mmu:74144.
    UCSCi uc009ous.1. mouse. [Q8C310-2 ]
    uc012gqy.1. mouse. [Q8C310-1 ]

    Organism-specific databases

    CTDi 54538.
    MGIi MGI:1921394. Robo4.

    Phylogenomic databases

    eggNOGi NOG325715.
    GeneTreei ENSGT00750000117765.
    HOGENOMi HOG000074193.
    HOVERGENi HBG061836.
    KOi K06784.
    PhylomeDBi Q8C310.
    TreeFami TF351053.

    Miscellaneous databases

    NextBioi 339894.
    PROi Q8C310.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8C310.
    Bgeei Q8C310.
    CleanExi MM_ROBO4.
    Genevestigatori Q8C310.

    Family and domain databases

    Gene3Di 2.60.40.10. 4 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    [Graphical view ]
    Pfami PF00041. fn3. 1 hit.
    PF07679. I-set. 1 hit.
    [Graphical view ]
    SMARTi SM00060. FN3. 2 hits.
    SM00409. IG. 1 hit.
    SM00408. IGc2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 1 hit.
    PROSITEi PS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Robo4 is a vascular-specific receptor that inhibits endothelial migration."
      Park K.W., Morrison C.M., Sorensen L.K., Jones C.A., Rao Y., Chien C.-B., Wu J.Y., Urness L.D., Li D.Y.
      Dev. Biol. 261:251-267(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH SLIT2 AND ENAH, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: FVB/N.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Strain: C57BL/6J.
      Tissue: Lung.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 475-1012 (ISOFORM 2).

    Entry informationi

    Entry nameiROBO4_MOUSE
    AccessioniPrimary (citable) accession number: Q8C310
    Secondary accession number(s): Q9DBW1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2004
    Last sequence update: June 21, 2004
    Last modified: October 1, 2014
    This is version 101 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3