Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8C310 (ROBO4_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Roundabout homolog 4
Gene names
Name:Robo4
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1012 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for Slit proteins, at least for SLIT2, and seems to be involved in angiogenesis and vascular patterning. May mediate the inhibition of primary endothelial cell migration by Slit proteins. Ref.1

Subunit structure

Interacts with SLIT2 and ENAH. Ref.1

Tissue specificity

Expressed specifically in embryo and adult vascular endothelium. Ref.1

Developmental stage

In embryonic development of vascular endothelium shows a dynamic expression pattern within vessels, with expression starting in the larger axial vessels and intersomitic vessels at earlier ages, and changing to intersomitic vessel and capillary expression at later stages. At E9.0, is expressed in the central vessels, the dorsal aorta, and intersomitic vessels. At E9.5, is highly expressed in intersomitic vessels with little expression remaining in dorsal aortae. By E10.0, is detected in capillary vessels, the capillary plexus of the limb buds, and throughout the endothelium as microvessels sprout from the dorsal aortae. No expression was detected in the neural tube at E9.0 and E9.5. However, it is detected within the capillaries sprouting into the neural tube, as well as in the adjacent perineural capillary plexus at E10.0. Ref.1

Sequence similarities

Belongs to the immunoglobulin superfamily. ROBO family.

Contains 2 fibronectin type-III domains.

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Sequence caution

The sequence AAH20129.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB23506.2 differs from that shown. Reason: Erroneous initiation.

Isoform 2: The sequence BAB23506.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Isoform 2: The sequence AAH20129.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Isoform 3: The sequence BAC39850.1 differs from that shown. Reason: Frameshift at positions 916 and 919.

Isoform 3: The sequence BAC39850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8C310-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8C310-2)

The sequence of this isoform differs from the canonical sequence as follows:
     688-694: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8C310-3)

The sequence of this isoform differs from the canonical sequence as follows:
     440-440: L → LGEGKALSISSTPPPCRPSVSQFLSYIFSSSLSCLLVPLTVPLALPLSSTSQT
     688-694: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2727 Potential
Chain28 – 1012985Roundabout homolog 4
PRO_0000031041

Regions

Domain32 – 132101Ig-like C2-type 1
Domain138 – 22588Ig-like C2-type 2
Domain249 – 34698Fibronectin type-III 1
Domain348 – 44396Fibronectin type-III 2

Amino acid modifications

Glycosylation2011N-linked (GlcNAc...) Potential
Glycosylation2471N-linked (GlcNAc...) Potential
Glycosylation3611N-linked (GlcNAc...) Potential
Glycosylation3901N-linked (GlcNAc...) Potential
Glycosylation3971N-linked (GlcNAc...) Potential
Glycosylation6811N-linked (GlcNAc...) Potential
Glycosylation7131N-linked (GlcNAc...) Potential
Glycosylation7621N-linked (GlcNAc...) Potential
Glycosylation7831N-linked (GlcNAc...) Potential
Disulfide bond53 ↔ 115 Potential
Disulfide bond159 ↔ 208 Potential

Natural variations

Alternative sequence4401L → LGEGKALSISSTPPPCRPSV SQFLSYIFSSSLSCLLVPLT VPLALPLSSTSQT in isoform 3.
VSP_010663
Alternative sequence688 – 6947Missing in isoform 2 and isoform 3.
VSP_010662

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 21, 2004. Version 2.
Checksum: 9116352CAE767CC1

FASTA1,012108,499
        10         20         30         40         50         60 
MGSGGTGLLG TEWPLPLLLL FIMGGEALDS PPQILVHPQD QLLQGSGPAK MRCRSSGQPP 

        70         80         90        100        110        120 
PTIRWLLNGQ PLSMATPDLH YLLPDGTLLL HRPSVQGRPQ DDQNILSAIL GVYTCEASNR 

       130        140        150        160        170        180 
LGTAVSRGAR LSVAVLQEDF QIQPRDTVAV VGESLVLECG PPWGYPKPSV SWWKDGKPLV 

       190        200        210        220        230        240 
LQPGRRTVSG DSLMVSRAEK NDSGTYMCMA TNNAGQRESR AARVSIQESQ DHKEHLELLA 

       250        260        270        280        290        300 
VRIQLENVTL LNPEPVKGPK PGPSVWLSWK VSGPAAPAES YTALFRTQRS PRDQGSPWTE 

       310        320        330        340        350        360 
VLLRGLQSAK LGGLHWGQDY EFKVRPSSGR ARGPDSNVLL LRLPEQVPSA PPQGVTLRSG 

       370        380        390        400        410        420 
NGSVFVSWAP PPAESHNGVI RGYQVWSLGN ASLPAANWTV VGEQTQLEIA TRLPGSYCVQ 

       430        440        450        460        470        480 
VAAVTGAGAG ELSTPVCLLL EQAMEQSARD PRKHVPWTLE QLRATLRRPE VIASSAVLLW 

       490        500        510        520        530        540 
LLLLGITVCI YRRRKAGVHL GPGLYRYTSE DAILKHRMDH SDSPWLADTW RSTSGSRDLS 

       550        560        570        580        590        600 
SSSSLSSRLG LDPRDPLEGR RSLISWDPRS PGVPLLPDTS TFYGSLIAEQ PSSPPVRPSP 

       610        620        630        640        650        660 
KTPAARRFPS KLAGTSSPWA SSDSLCSRRG LCSPRMSLTP TEAWKAKKKQ ELHQANSSPL 

       670        680        690        700        710        720 
LRGSHPMEIW AWELGSRASK NLSQSPGPNS GSPGEAPRAV VSWRAVGPQL HRNSSELASR 

       730        740        750        760        770        780 
PLPPTPLSLR GASSHDPQSQ CVEKLQAPSS DPLPAAPLSV LNSSRPSSPQ ASFLSCPSPS 

       790        800        810        820        830        840 
SSNLSSSSLS SLEEEEDQDS VLTPEEVALC LELSDGEETP TNSVSPMPRA PSPPTTYGYI 

       850        860        870        880        890        900 
SIPTCSGLAD MGRAGGGVGS EVGNLLYPPR PCPTPTPSEG SLANGWGSAS EDNVPSARAS 

       910        920        930        940        950        960 
LVSSSDGSFL ADTHFARALA VAVDSFGLSL DPREADCVFT DASSPPSPRG DLSLTRSFSL 

       970        980        990       1000       1010 
PLWEWRPDWL EDAEISHTQR LGRGLPPWPP DSRASSQRSW LTGAVPKAGD SS 

« Hide

Isoform 2 [UniParc].

Checksum: 95F8C43EE184E21E
Show »

FASTA1,005107,903
Isoform 3 [UniParc].

Checksum: BDC167380727CBF7
Show »

FASTA1,057113,251

References

« Hide 'large scale' references
[1]"Robo4 is a vascular-specific receptor that inhibits endothelial migration."
Park K.W., Morrison C.M., Sorensen L.K., Jones C.A., Rao Y., Chien C.-B., Wu J.Y., Urness L.D., Li D.Y.
Dev. Biol. 261:251-267(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH SLIT2 AND ENAH, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Strain: FVB/N.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: C57BL/6J.
Tissue: Lung.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 475-1012 (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF536772 mRNA. Translation: AAQ10749.1.
AK004723 mRNA. Translation: BAB23506.2. Different initiation.
AK087355 mRNA. Translation: BAC39850.1. Sequence problems.
BC020129 mRNA. Translation: AAH20129.1. Different initiation.
RefSeqNP_083059.2. NM_028783.2.
UniGeneMm.485070.

3D structure databases

ProteinModelPortalQ8C310.
SMRQ8C310. Positions 8-441.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid216523. 1 interaction.
STRING10090.ENSMUSP00000110698.

PTM databases

PhosphoSiteQ8C310.

Proteomic databases

PaxDbQ8C310.
PRIDEQ8C310.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000102895; ENSMUSP00000099959; ENSMUSG00000032125.
GeneID74144.
KEGGmmu:74144.
UCSCuc009ous.1. mouse. [Q8C310-2]
uc012gqy.1. mouse. [Q8C310-1]

Organism-specific databases

CTD54538.
MGIMGI:1921394. Robo4.

Phylogenomic databases

eggNOGNOG325715.
GeneTreeENSGT00750000117765.
HOGENOMHOG000074193.
HOVERGENHBG061836.
KOK06784.
PhylomeDBQ8C310.
TreeFamTF351053.

Gene expression databases

ArrayExpressQ8C310.
BgeeQ8C310.
CleanExMM_ROBO4.
GenevestigatorQ8C310.

Family and domain databases

Gene3D2.60.40.10. 4 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamPF00041. fn3. 1 hit.
PF07679. I-set. 1 hit.
[Graphical view]
SMARTSM00060. FN3. 2 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMSSF49265. SSF49265. 1 hit.
PROSITEPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio339894.
PROQ8C310.
SOURCESearch...

Entry information

Entry nameROBO4_MOUSE
AccessionPrimary (citable) accession number: Q8C310
Secondary accession number(s): Q9DBW1
Entry history
Integrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: June 11, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot