Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein Eos

Gene

Ikzf4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

DNA-binding protein that binds to the 5'GGGAATRCC-3' Ikaros-binding sequence. Interacts with SPI1 and MITF to repress transcription of the CTSK and ACP5 promoters via recruitment of corepressors SIN3A and CTBP2. May be involved in the development of central and peripheral nervous systems. Essential for the inhibitory function of regulatory T-cells (Treg). Mediates FOXP3-mediated gene silencing in regulatory T-cells (Treg) via recruitment of corepressor CTBP1 (PubMed:19696312).3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri159 – 18123C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri187 – 20923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri215 – 23723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri248 – 27124C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri531 – 55323C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri559 – 58325C2H2-type 6PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • bHLH transcription factor binding Source: MGI
  • metal ion binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: MGI
  • protein homodimerization activity Source: MGI
  • sequence-specific DNA binding Source: MGI

GO - Biological processi

  • negative regulation of transcription, DNA-templated Source: MGI
  • positive regulation of transcription from RNA polymerase II promoter Source: MGI
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein Eos
Alternative name(s):
Ikaros family zinc finger protein 4
Gene namesi
Name:Ikzf4
Synonyms:Zfpn1a4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1343139. Ikzf4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 586586Zinc finger protein EosPRO_0000299469Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei105 – 1051PhosphoserineBy similarity
Modified residuei335 – 3351N6-acetyllysineBy similarity
Cross-linki501 – 501Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8C208.
MaxQBiQ8C208.
PaxDbiQ8C208.
PRIDEiQ8C208.

PTM databases

PhosphoSiteiQ8C208.

Expressioni

Tissue specificityi

Expressed mainly in the brain. Up-regulated in long term cultured astrocytes. Down-regulated during osteoclast differentiation.2 Publications

Developmental stagei

Highly expressed in the brain at E15 and E18. Expression gradually decreased as postnatal development proceeded. No expression detected in the liver, kidney, lung, thymus or spleen during all developmental stages.1 Publication

Gene expression databases

BgeeiQ8C208.
CleanExiMM_IKZF4.
ExpressionAtlasiQ8C208. baseline and differential.
GenevisibleiQ8C208. MM.

Interactioni

Subunit structurei

Self-associates. Interacts with other family members; IKZF1, IKZF2, IKZF3 AND IKZF5 (By similarity). Interacts with CTBP2, SPI1 and MITF. Interacts with FOXP3 and CTBP1.By similarity4 Publications

GO - Molecular functioni

  • bHLH transcription factor binding Source: MGI
  • protein heterodimerization activity Source: MGI
  • protein homodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi204703. 1 interaction.
STRINGi10090.ENSMUSP00000114404.

Structurei

3D structure databases

ProteinModelPortaliQ8C208.
SMRiQ8C208. Positions 154-267, 491-561.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni281 – 586306Interaction with FOXP31 PublicationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi423 – 43311CTBP-binding motif PEDLGAdd
BLAST

Domaini

The N-terminal zinc fingers are involved in sequence-specific DNA binding.
C-terminal zinc fingers mediate homodimerization.

Sequence similaritiesi

Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri159 – 18123C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri187 – 20923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri215 – 23723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri248 – 27124C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri531 – 55323C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri559 – 58325C2H2-type 6PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00550000074392.
HOGENOMiHOG000049114.
HOVERGENiHBG004752.
InParanoidiQ8C208.
KOiK09220.
OMAiQPSSDKM.
OrthoDBiEOG79GT61.
PhylomeDBiQ8C208.
TreeFamiTF331189.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 6 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C208-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHTPPALPRR FQGGGRVRTP GSHRQGKDNL ERELSGGCAP DFLPQAQDSN
60 70 80 90 100
HFIMESLFCE SSGDSSLEKE FLGAPVGPSV STPNSQHSSP SRSLSANSIK
110 120 130 140 150
VEMYSDEESS RLLGPDERLL DKDDSVIVED SLSEPLGYCD GSGPEPHSPG
160 170 180 190 200
GIRLPNGKLK CDVCGMVCIG PNVLMVHKRS HTGERPFHCN QCGASFTQKG
210 220 230 240 250
NLLRHIKLHS GEKPFKCPFC NYACRRRDAL TGHLRTHSVS SPTVGKPYKC
260 270 280 290 300
NYCGRSYKQQ STLEEHKERC HNYLQSLSTD AQALTGQPGD EIRDLEMVPD
310 320 330 340 350
SMLHPSTERP TFIDRLANSL TKRKRSTPQK FVGEKQMRFS LSDLPYDVNA
360 370 380 390 400
SGGYEKDVEL VAHHGLEPGF GGSLAFVGTE HLRPLRLPPT NCISELTPVI
410 420 430 440 450
SSVYTQMQPI PSRLELPGSR EAGEGPEDLG DGGPLLYRAR GSLTDPGASP
460 470 480 490 500
SNGCQDSTDT ESNHEDRIGG VVSLPQGPPP QPPPTIVVGR HSPAYAKEDP
510 520 530 540 550
KPQEGLLRGT PGPSKEVLRV VGESGEPVKA FKCEHCRILF LDHVMFTIHM
560 570 580
GCHGFRDPFE CNICGYHSQD RYEFSSHIVR GEHKVG
Length:586
Mass (Da):64,155
Last modified:September 11, 2007 - v2
Checksum:iBC39FF5BBE7F914C
GO
Isoform 2 (identifier: Q8C208-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.

Show »
Length:533
Mass (Da):58,335
Checksum:iBDFCCC00C23C5746
GO
Isoform 3 (identifier: Q8C208-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERELSGGCAPDFLPQAQDSNHFIMESLFCES → MFIPVG

Note: No experimental confirmation available.
Show »
Length:531
Mass (Da):58,052
Checksum:i7DA51FC4203BC451
GO
Isoform 4 (identifier: Q8C208-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     572-586: YEFSSHIVRGEHKVG → TRRLVPRLLG...SSIAGGSLSL

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):75,075
Checksum:iAAF4318A96EA1307
GO

Sequence cautioni

The sequence BAA36213.1 differs from that shown. Reason: Frameshift at positions 472 and 479. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 712EF → DS in BAA36213 (PubMed:10218586).Curated
Sequence conflicti291 – 2911E → V in BAE41808 (PubMed:16141072).Curated
Sequence conflicti352 – 3521G → S in BAE41808 (PubMed:16141072).Curated
Sequence conflicti478 – 4781P → T in BAC40912 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6161MHTPP…LFCES → MFIPVG in isoform 3. 1 PublicationVSP_027689Add
BLAST
Alternative sequencei1 – 5353Missing in isoform 2. 2 PublicationsVSP_027690Add
BLAST
Alternative sequencei572 – 58615YEFSS…EHKVG → TRRLVPRLLGPVMINGREKG DVSFLSANFQYNQKNCPRMN YTYVPVNHSTLVPARMGRTQ LGVTSTALSILSSRHRAGEA VFSGGCRHSGYSDNRGFVRP CRRRHSSIAGGSLSL in isoform 4. 1 PublicationVSP_027691Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017615 mRNA. Translation: BAA36213.1. Frameshift.
AK089522 mRNA. Translation: BAC40912.1.
AK170453 mRNA. Translation: BAE41808.1.
AC117232 Genomic DNA. No translation available.
BC141286 mRNA. Translation: AAI41287.1.
CCDSiCCDS24284.2. [Q8C208-1]
RefSeqiNP_035902.2. NM_011772.2. [Q8C208-1]
XP_006513677.1. XM_006513614.1. [Q8C208-3]
XP_006513678.1. XM_006513615.1. [Q8C208-3]
XP_011241744.1. XM_011243442.1. [Q8C208-2]
UniGeneiMm.358648.

Genome annotation databases

EnsembliENSMUST00000065334; ENSMUSP00000066991; ENSMUSG00000002578. [Q8C208-4]
ENSMUST00000119614; ENSMUSP00000113478; ENSMUSG00000002578. [Q8C208-2]
ENSMUST00000133342; ENSMUSP00000114404; ENSMUSG00000002578. [Q8C208-1]
GeneIDi22781.
KEGGimmu:22781.
UCSCiuc007hnp.1. mouse. [Q8C208-1]
uc011xqg.1. mouse. [Q8C208-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017615 mRNA. Translation: BAA36213.1. Frameshift.
AK089522 mRNA. Translation: BAC40912.1.
AK170453 mRNA. Translation: BAE41808.1.
AC117232 Genomic DNA. No translation available.
BC141286 mRNA. Translation: AAI41287.1.
CCDSiCCDS24284.2. [Q8C208-1]
RefSeqiNP_035902.2. NM_011772.2. [Q8C208-1]
XP_006513677.1. XM_006513614.1. [Q8C208-3]
XP_006513678.1. XM_006513615.1. [Q8C208-3]
XP_011241744.1. XM_011243442.1. [Q8C208-2]
UniGeneiMm.358648.

3D structure databases

ProteinModelPortaliQ8C208.
SMRiQ8C208. Positions 154-267, 491-561.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204703. 1 interaction.
STRINGi10090.ENSMUSP00000114404.

PTM databases

PhosphoSiteiQ8C208.

Proteomic databases

EPDiQ8C208.
MaxQBiQ8C208.
PaxDbiQ8C208.
PRIDEiQ8C208.

Protocols and materials databases

DNASUi22781.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000065334; ENSMUSP00000066991; ENSMUSG00000002578. [Q8C208-4]
ENSMUST00000119614; ENSMUSP00000113478; ENSMUSG00000002578. [Q8C208-2]
ENSMUST00000133342; ENSMUSP00000114404; ENSMUSG00000002578. [Q8C208-1]
GeneIDi22781.
KEGGimmu:22781.
UCSCiuc007hnp.1. mouse. [Q8C208-1]
uc011xqg.1. mouse. [Q8C208-3]

Organism-specific databases

CTDi64375.
MGIiMGI:1343139. Ikzf4.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00550000074392.
HOGENOMiHOG000049114.
HOVERGENiHBG004752.
InParanoidiQ8C208.
KOiK09220.
OMAiQPSSDKM.
OrthoDBiEOG79GT61.
PhylomeDBiQ8C208.
TreeFamiTF331189.

Miscellaneous databases

ChiTaRSiIkzf4. mouse.
NextBioi303347.
PROiQ8C208.
SOURCEiSearch...

Gene expression databases

BgeeiQ8C208.
CleanExiMM_IKZF4.
ExpressionAtlasiQ8C208. baseline and differential.
GenevisibleiQ8C208. MM.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 6 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Eos: a novel member of the Ikaros gene family expressed predominantly in the developing nervous system."
    Honma Y., Kiyosawa H., Mori T., Oguri A., Nikaido T., Kanazawa K., Tojo M., Takeda J., Tanno Y., Yokoya S., Kawabata I., Ikeda H., Wanaka A.
    FEBS Lett. 447:76-80(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH IKZF1, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: ICR.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Strain: NOD.
    Tissue: Dendritic cell.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "The Ikaros family protein Eos associates with C-terminal-binding protein corepressors."
    Perdomo J., Crossley M.
    Eur. J. Biochem. 269:5885-5892(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CTBP2.
  6. "Eos, MITF, and PU.1 recruit corepressors to osteoclast-specific genes in committed myeloid progenitors."
    Hu R., Sharma S.M., Bronisz A., Srinivasan R., Sankar U., Ostrowski M.C.
    Mol. Cell. Biol. 27:4018-4027(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH SPI1 AND MITF.
  7. Cited for: FUNCTION, INTERACTION WITH FOXP3 AND CTBP1.

Entry informationi

Entry nameiIKZF4_MOUSE
AccessioniPrimary (citable) accession number: Q8C208
Secondary accession number(s): B9EJ21, Q3TCZ7, Q9Z2Z2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: May 11, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Eos is a Greek word for rising sun.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.