Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Telomere repeats-binding bouquet formation protein 1

Gene

Terb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis (PubMed:24413433, PubMed:26548954). Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA (PubMed:26548954). In the MAJIN-TERB1-TERB2 complex, TERB1 probably mediates association with the shelterin/telosome complex via interaction with TERF1, promoting priming telomeric DNA attachment' (PubMed:26548954). Promotes telomere association with the nuclear envelope and deposition of the SUN-KASH/LINC complex (PubMed:24413433). Also recruits cohesin to telomeres to develop structural rigidity (PubMed:24413433).2 Publications

GO - Molecular functioni

GO - Biological processi

  • meiotic attachment of telomere to nuclear envelope Source: UniProtKB
  • meiotic telomere clustering Source: UniProtKB
  • synapsis Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Meiosis

Names & Taxonomyi

Protein namesi
Recommended name:
Telomere repeats-binding bouquet formation protein 11 Publication
Alternative name(s):
Coiled-coil domain-containing protein 79
Gene namesi
Name:Terb11 Publication
Synonyms:Ccdc79Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2443187. Terb1.

Subcellular locationi

GO - Cellular componenti

  • chromosome, telomeric region Source: UniProtKB
  • nuclear chromosome, telomeric region Source: UniProtKB
  • nuclear inner membrane Source: UniProtKB
  • telosome Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Membrane, Nucleus, Telomere

Pathology & Biotechi

Disruption phenotypei

Mice develop normally, exhibit no overt phenotype, but are infertile (both males and females). Testis lack postmeiotic cells due to massive elimination of spermatocytes, while females show degeneration of the ovaries, lacking growing follicles and mature oocytes.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi648T → A: Telomere-attachment defects. 1 Publication1
Mutagenesisi648T → D: Mimics phosphorylation state; impairs interaction with TERF1. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003201571 – 768Telomere repeats-binding bouquet formation protein 1Add BLAST768

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei648Phosphothreonine1 Publication1 Publication1

Post-translational modificationi

Phosphorylated by CDK (PubMed:24413433, PubMed:26548954). Phosphorylation by CDK takes place in late prophase when the cap exchange is prominent (PubMed:26548954). is important for the stabilization of telomere attachment but dispenable for the cap exchange (PubMed:26548954).2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8C0V1.
PRIDEiQ8C0V1.

PTM databases

iPTMnetiQ8C0V1.
PhosphoSitePlusiQ8C0V1.

Expressioni

Tissue specificityi

Expressed in testis and fetal oocytes.1 Publication

Developmental stagei

Expressed during meiotic prophase and becomes undetectable in metaphase I in spermatocytes and oocytes (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000052616.
CleanExiMM_CCDC79.
ExpressionAtlasiQ8C0V1. baseline and differential.
GenevisibleiQ8C0V1. MM.

Interactioni

Subunit structurei

Component of the MAJIN-TERB1-TERB2 complex, composed of MAJIN, TERB1 and TERB2 (PubMed:26548954). Interacts with TERF1, STAG3 and SUN1 (PubMed:24413433). Interacts (via Myb-like domain) with the cohesin complex; probably mediated via interaction with STAG3 (PubMed:24413433).2 Publications

Protein-protein interaction databases

DIPiDIP-60728N.
IntActiQ8C0V1. 1 interactor.
STRINGi10090.ENSMUSP00000067324.

Structurei

Secondary structure

1768
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi712 – 714Combined sources3
Helixi717 – 730Combined sources14
Helixi734 – 740Combined sources7
Helixi749 – 760Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X58NMR-A712-760[»]
ProteinModelPortaliQ8C0V1.
SMRiQ8C0V1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8C0V1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati101 – 145ARM 1Add BLAST45
Repeati341 – 384ARM 2Add BLAST44
Domaini707 – 760Myb-likeAdd BLAST54

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni524 – 700Interaction with TERF11 PublicationAdd BLAST177

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili399 – 448Sequence analysisAdd BLAST50

Sequence similaritiesi

Belongs to the TERB1 family.Curated
Contains 2 ARM repeats.PROSITE-ProRule annotation
Contains 1 Myb-like domain.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IFKY. Eukaryota.
ENOG4111AM1. LUCA.
GeneTreeiENSGT00390000005075.
HOGENOMiHOG000168393.
HOVERGENiHBG107621.
InParanoidiQ8C0V1.
OMAiCIAVEKS.
OrthoDBiEOG091G08A8.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
[Graphical view]
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF48371. SSF48371. 1 hit.
PROSITEiPS50176. ARM_REPEAT. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C0V1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESEKPKKTQ EMKTDLKLLL ECLKYHMGNP LSQKEVLITI HSVCKQNSDA
60 70 80 90 100
GIYFREIGGL MFIINLAKSS EQSLVKEAAL YTLGSIAEEN VYCQQSLCTS
110 120 130 140 150
ELFQDLTGLL TNDDSNTNLK RMSVYVLLVL VSNNRNGQTL VREVGCIEVL
160 170 180 190 200
SQMFRTVLSN YELNLSDNSV FQSYLLWSSV CSTLCVCVNN PQNDENQMLC
210 220 230 240 250
CSLFPCVNEW LMNCMRPEVI RPICSFIGLT LANNTHAQNC FVSSGGLDVL
260 270 280 290 300
CQVLVQLESD SHNTLSSAKL AVIVTKTMDA CITDNSAAFT VVLSKYHIVS
310 320 330 340 350
TLLALLLHES LDSREKFSII LAIGHCTEDC EKNQYELLKN NGLPLMIQAL
360 370 380 390 400
TEFKNEDLSK AATYVLHNCK KITGKLSLSL GQNSFGENEI ELKDISEKET
410 420 430 440 450
LREHWKAAKE ILCRIKQFEK GGKEEKQQNR SGHYKDNTPS MKVNIQTNLK
460 470 480 490 500
RLCADSTGGT RAEDKDINQS RELRSYKPSE IMSKACANEN QLTTRKKNTN
510 520 530 540 550
PVHPFCKEKG QSKIVHETTP SCAQNLDKEK TFDQKDSVSQ SSDQVLKHLP
560 570 580 590 600
HTVKNRKQVP ETDPFTLCLD IIDREVGIQA TDSCSRMLKY TCSGCIVARK
610 620 630 640 650
LLNSRNFSKF LHSCAYQCVH HKVIMEAEDK YKNELRKTFI CAKKILLTPC
660 670 680 690 700
RRRQLCKEST ASEELKIVHQ KPDSKKLPGL EAQALNTSIP EAMERRSPVP
710 720 730 740 750
GQSGLHKKRR IRKDFTKEEV NYLFHGVKTM GNHWNSILWS FPFQKGRRAV
760
DLAHKYHRLI KGPSCAAL
Length:768
Mass (Da):86,835
Last modified:March 19, 2014 - v2
Checksum:iEEA1F16E6258BFA6
GO
Isoform 2 (identifier: Q8C0V1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MESEKPKKTQEMKTDLKLLLECLKYHMGNPLSQKEVLITIHSVCKQNS → MSEVSHGQPFVTKG
     707-768: KKRRIRKDFT...LIKGPSCAAL → SEFEATPGYIGKAHLKKRKRKKKENLQTSFSMM

Note: No experimental confirmation available.
Show »
Length:705
Mass (Da):79,253
Checksum:iAB743F08CEB9BE76
GO
Isoform 3 (identifier: Q8C0V1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-401: Missing.
     402-424: REHWKAAKEILCRIKQFEKGGKE → MKVLIQEKNLASYLPLVTAQRIV
     644-651: KILLTPCR → SNSFSNFN
     652-768: Missing.

Note: No experimental confirmation available.
Show »
Length:250
Mass (Da):28,535
Checksum:i0D4CB8ACC4A66A62
GO
Isoform 4 (identifier: Q8C0V1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-401: Missing.
     402-424: REHWKAAKEILCRIKQFEKGGKE → MKVLIQEKNLASYLPLVTAQRIV
     594-650: GCIVARKLLN...CAKKILLTPC → VCLYSYVGGF...EKTSSPELVA
     651-768: Missing.

Note: No experimental confirmation available.
Show »
Length:249
Mass (Da):27,968
Checksum:i127D7077A7EC7CC3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti211L → V in BAC26599 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0316161 – 401Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST401
Alternative sequenceiVSP_0316171 – 48MESEK…CKQNS → MSEVSHGQPFVTKG in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_031618402 – 424REHWK…KGGKE → MKVLIQEKNLASYLPLVTAQ RIV in isoform 3 and isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_031619594 – 650GCIVA…LLTPC → VCLYSYVGGFSYIEPPLHLA RARLARKNDAATGSFCTRLL GELDCRGEKTSSPELVA in isoform 4. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_031620644 – 651KILLTPCR → SNSFSNFN in isoform 3. 1 Publication8
Alternative sequenceiVSP_031621651 – 768Missing in isoform 4. 1 PublicationAdd BLAST118
Alternative sequenceiVSP_031622652 – 768Missing in isoform 3. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_031623707 – 768KKRRI…SCAAL → SEFEATPGYIGKAHLKKRKR KKKENLQTSFSMM in isoform 2. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029754 mRNA. Translation: BAC26599.1.
AK030157 mRNA. Translation: BAC26814.1.
AC130543 Genomic DNA. No translation available.
BC113771 mRNA. Translation: AAI13772.1.
BC129814 mRNA. Translation: AAI29815.1.
CCDSiCCDS22580.1. [Q8C0V1-1]
RefSeqiNP_851289.2. NM_180958.3. [Q8C0V1-1]
XP_006531157.1. XM_006531094.2. [Q8C0V1-1]
XP_017168345.1. XM_017312856.1. [Q8C0V1-1]
UniGeneiMm.249775.

Genome annotation databases

EnsembliENSMUST00000064576; ENSMUSP00000067324; ENSMUSG00000052616. [Q8C0V1-1]
GeneIDi320022.
KEGGimmu:320022.
UCSCiuc009naq.1. mouse. [Q8C0V1-1]
uc009nar.1. mouse. [Q8C0V1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029754 mRNA. Translation: BAC26599.1.
AK030157 mRNA. Translation: BAC26814.1.
AC130543 Genomic DNA. No translation available.
BC113771 mRNA. Translation: AAI13772.1.
BC129814 mRNA. Translation: AAI29815.1.
CCDSiCCDS22580.1. [Q8C0V1-1]
RefSeqiNP_851289.2. NM_180958.3. [Q8C0V1-1]
XP_006531157.1. XM_006531094.2. [Q8C0V1-1]
XP_017168345.1. XM_017312856.1. [Q8C0V1-1]
UniGeneiMm.249775.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X58NMR-A712-760[»]
ProteinModelPortaliQ8C0V1.
SMRiQ8C0V1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-60728N.
IntActiQ8C0V1. 1 interactor.
STRINGi10090.ENSMUSP00000067324.

PTM databases

iPTMnetiQ8C0V1.
PhosphoSitePlusiQ8C0V1.

Proteomic databases

PaxDbiQ8C0V1.
PRIDEiQ8C0V1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000064576; ENSMUSP00000067324; ENSMUSG00000052616. [Q8C0V1-1]
GeneIDi320022.
KEGGimmu:320022.
UCSCiuc009naq.1. mouse. [Q8C0V1-1]
uc009nar.1. mouse. [Q8C0V1-2]

Organism-specific databases

CTDi283847.
MGIiMGI:2443187. Terb1.

Phylogenomic databases

eggNOGiENOG410IFKY. Eukaryota.
ENOG4111AM1. LUCA.
GeneTreeiENSGT00390000005075.
HOGENOMiHOG000168393.
HOVERGENiHBG107621.
InParanoidiQ8C0V1.
OMAiCIAVEKS.
OrthoDBiEOG091G08A8.

Miscellaneous databases

EvolutionaryTraceiQ8C0V1.
PROiQ8C0V1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000052616.
CleanExiMM_CCDC79.
ExpressionAtlasiQ8C0V1. baseline and differential.
GenevisibleiQ8C0V1. MM.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
[Graphical view]
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF48371. SSF48371. 1 hit.
PROSITEiPS50176. ARM_REPEAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTERB1_MOUSE
AccessioniPrimary (citable) accession number: Q8C0V1
Secondary accession number(s): A1L2Z9
, E9QPF2, Q14CI1, Q8C0N5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: March 19, 2014
Last modified: November 30, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.