Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enolase 4

Gene

Eno4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for sperm motility, function and male fertility. May be involved in the normal assembly of the sperm fibrous sheath and provides most of the enolase activity in sperm (PubMed:23446454).1 Publication

Catalytic activityi

2-phospho-D-glycerate = phosphoenolpyruvate + H2O.1 Publication

Pathwayi: glycolysis

This protein is involved in step 4 of the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate.1 Publication
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Glyceraldehyde-3-phosphate dehydrogenase (Gapdh), Glyceraldehyde-3-phosphate dehydrogenase (Gapdh), Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Glyceraldehyde-3-phosphate dehydrogenase (Gapdh), Glyceraldehyde-3-phosphate dehydrogenase (Gapdhs), Glyceraldehyde-3-phosphate dehydrogenase (Gm10358), Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (Gapdhs), Glyceraldehyde-3-phosphate dehydrogenase (Gapdhs), Glyceraldehyde-3-phosphate dehydrogenase (Gm3839)
  2. Phosphoglycerate kinase 2 (Pgk2), Phosphoglycerate kinase 1 (Pgk1)
  3. no protein annotated in this organism
  4. Gamma-enolase (Eno2), Alpha-enolase (Eno1), Beta-enolase (Eno3), Enolase 4 (Eno4)
  5. Pyruvate kinase (Pklr), Pyruvate kinase (Pklr), Pyruvate kinase PKLR (Pklr), Pyruvate kinase (Pklr), Pyruvate kinase (Pklr), Pyruvate kinase (Pklr), Pyruvate kinase PKM (Pkm)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei302SubstrateBy similarity1
Active sitei497Proton acceptorBy similarity1
Binding sitei548SubstrateBy similarity1

GO - Molecular functioni

  • magnesium ion binding Source: InterPro
  • phosphopyruvate hydratase activity Source: MGI
  • protein heterodimerization activity Source: MGI

GO - Biological processi

  • cilium organization Source: MGI
  • flagellated sperm motility Source: MGI
  • glycolytic process Source: MGI

Keywordsi

Molecular functionLyase
Biological processGlycolysis

Enzyme and pathway databases

UniPathwayiUPA00109; UER00187.

Names & Taxonomyi

Protein namesi
Recommended name:
Enolase 41 Publication (EC:4.2.1.11)
Alternative name(s):
2-phospho-D-glycerate hydro-lyase
Gene namesi
Name:Eno4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:2441717. Eno4.

Subcellular locationi

GO - Cellular componenti

  • phosphopyruvate hydratase complex Source: InterPro
  • sperm principal piece Source: MGI

Pathology & Biotechi

Disruption phenotypei

Male mice are infertile and the sperm have significantly reduced motility, ATP levels, and enolase enzymatic activity as well as a structurally abnormal sperm fibrous sheath.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003484551 – 619Enolase 4Add BLAST619

Proteomic databases

PaxDbiQ8C042.
PRIDEiQ8C042.

PTM databases

iPTMnetiQ8C042.
PhosphoSitePlusiQ8C042.

Expressioni

Tissue specificityi

Testis-specific. Isoform 4 is expressed at higher levels in late spermatids than in pachytene spermatocytes. Isoform 5 is expressed at higher levels in pachytene spermatocytes than in late spermatids.1 Publication

Gene expression databases

BgeeiENSMUSG00000048029.
ExpressionAtlasiQ8C042. baseline and differential.
GenevisibleiQ8C042. MM.

Interactioni

Subunit structurei

Interacts with ENO1 (PubMed:23446454). Isoform 1 and isoform 4 interact with AKAP4 (PubMed:23446454).1 Publication

GO - Molecular functioni

  • protein heterodimerization activity Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000062584.

Structurei

3D structure databases

ProteinModelPortaliQ8C042.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi188 – 233Pro-richAdd BLAST46

Sequence similaritiesi

Belongs to the enolase family.Curated

Phylogenomic databases

eggNOGiKOG2670. Eukaryota.
COG0148. LUCA.
GeneTreeiENSGT00840000129946.
HOGENOMiHOG000168691.
HOVERGENiHBG107850.
InParanoidiQ8C042.
OMAiNCFSKLA.
OrthoDBiEOG091G041E.
TreeFamiTF354238.

Family and domain databases

Gene3Di3.20.20.120. 1 hit.
3.30.390.10. 1 hit.
InterProiView protein in InterPro
IPR000941. Enolase.
IPR020810. Enolase_C.
IPR029065. Enolase_C-like.
IPR020811. Enolase_N.
IPR029017. Enolase_N-like.
PANTHERiPTHR11902. PTHR11902. 1 hit.
PfamiView protein in Pfam
PF00113. Enolase_C. 1 hit.
PF03952. Enolase_N. 1 hit.
SMARTiView protein in SMART
SM01192. Enolase_C. 1 hit.
SM01193. Enolase_N. 1 hit.
SUPFAMiSSF51604. SSF51604. 1 hit.
SSF54826. SSF54826. 2 hits.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C042-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDEDGGRRG GITRDLQKLK QQAMAYYQEN DVPRKLEDLL NSTFYLQPAD
60 70 80 90 100
VYGHLKANYF SKLAKPPSIC KIVGKTILDG LGLPTLQVEI SCTIQNFPKY
110 120 130 140 150
ICAVAIPTHF EVVENALPEA LDAEDSERAQ AVNTAVQWIN QSITEELWGL
160 170 180 190 200
VPSNQAEVDH RLRTFFEHKV QEDKERKELE KSQEELVPAP PPVTLPPPPP
210 220 230 240 250
PPPPPPSKKK GQKAGRRDTL LEKPVSPPEP PEPVLHGSMA IGAVSLAVAK
260 270 280 290 300
ASATLASDPL YLTLASLKHD QEQPSTFSMP LLMGSVLSCG KSSPGKLHLM
310 320 330 340 350
KEVICIPSPG LTAKQSVELL LEIQKQVNRA METLPPPKQE TKKGHNGSKR
360 370 380 390 400
AQPPITGKVS HLGCLTINYD AIEQPLLLLQ GICSNLGLEL GVNFHLAINC
410 420 430 440 450
AGHELMDYSK GKYEVMVGTH KSAAEMVELY VDLINKYPSI IALIDPFRKE
460 470 480 490 500
DAEQWDSLYA ALASRCYLIA GAASGSVSKL LECRNISTLK SHGLIIKHTN
510 520 530 540 550
QTTMSDLVEI THLINGKKLL AVFGSTDSES SDDSLVDLAV GFGARFIKLG
560 570 580 590 600
GLSRGERMTK YNRLLAIEEE LIQRGVWGFS EEHNFSFFQE DATATMAEET
610
LGLLDSIFPT EVIEESAKT
Length:619
Mass (Da):67,853
Last modified:July 27, 2011 - v2
Checksum:i9EE6C085A3438AFC
GO
Isoform 2 (identifier: Q8C042-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     578-589: Missing.

Show »
Length:607
Mass (Da):66,395
Checksum:i645539169E766509
GO
Isoform 3 (identifier: Q8C042-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     579-584: FSEEHN → CYCHNG
     585-619: Missing.

Note: No experimental confirmation available.
Show »
Length:584
Mass (Da):63,936
Checksum:iDE1F2F9980277D24
GO
Isoform 4 (identifier: Q8C042-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     539-619: AVGFGARFIK...TEVIEESAKT → VSVKNTIFLSFKRMLLPQWLRKLLGSWTPSSPQR

Show »
Length:572
Mass (Da):62,780
Checksum:i1DB0285F704D57BA
GO
Isoform 5 (identifier: Q8C042-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-238: Missing.

Show »
Length:381
Mass (Da):41,381
Checksum:iFB88A5F6B48CDB05
GO

Sequence cautioni

The sequence AAH23285 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC36444 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti161R → W in BAC27851 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0582291 – 238Missing in isoform 5. 1 PublicationAdd BLAST238
Alternative sequenceiVSP_058230539 – 619AVGFG…ESAKT → VSVKNTIFLSFKRMLLPQWL RKLLGSWTPSSPQR in isoform 4. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_035167578 – 589Missing in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_035168579 – 584FSEEHN → CYCHNG in isoform 3. 1 Publication6
Alternative sequenceiVSP_035169585 – 619Missing in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032395 mRNA. Translation: BAC27851.1.
AK076682 mRNA. Translation: BAC36444.1. Different initiation.
AC102604 Genomic DNA. No translation available.
BC023285 mRNA. Translation: AAH23285.1. Different initiation.
RefSeqiNP_848804.2. NM_178689.4.
UniGeneiMm.103154.

Genome annotation databases

EnsembliENSMUST00000054280; ENSMUSP00000062584; ENSMUSG00000048029. [Q8C042-1]
GeneIDi226265.
KEGGimmu:226265.
UCSCiuc012bob.1. mouse. [Q8C042-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiENO4_MOUSE
AccessioniPrimary (citable) accession number: Q8C042
Secondary accession number(s): E9QLA7, Q8BVS9, Q8CFL9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 27, 2011
Last modified: May 10, 2017
This is version 102 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

Although it belongs to the enolase family, Leu-362 is present instead of the conserved Glu which is expected to be an active site residue.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families