Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tripartite motif-containing protein 35

Gene

Trim35

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a tumor suppressor. Implicated in the cell death mechanism.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri21 – 6141RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri96 – 13742B box-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Tripartite motif-containing protein 35
Alternative name(s):
Hemopoietic lineage switch protein 5
Macrophage-derived apoptosis-inducing RBCC protein
Short name:
Protein MAIR
Protein Nc8
Gene namesi
Name:Trim35
Synonyms:Hls5, Kiaa1098, Mair
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1914104. Trim35.

Subcellular locationi

  • Cytoplasm
  • Nucleus

  • Note: Found predominantly in cytoplasm with a granular distribution. Found in punctuate nuclear bodies.

GO - Cellular componenti

  • cytoplasm Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 501501Tripartite motif-containing protein 35PRO_0000056251Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei8 – 81PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8C006.
MaxQBiQ8C006.
PaxDbiQ8C006.
PeptideAtlasiQ8C006.
PRIDEiQ8C006.

PTM databases

iPTMnetiQ8C006.
PhosphoSiteiQ8C006.

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in brain, heart, kidney, spleen, skeletal muscle, lung and thymus. Lower expression found in stomach, large intestine and bone marrow.2 Publications

Developmental stagei

At 10.5 dpc expression was detected in branchial arches 1 and 2 and the fronto-nasal process, limb buds, spinal cord, and dorsal root ganglia. At 12.0 dpc expression was detected primarily in the limbs and transiently in the developing eye. By 13.5 dpc, expression in the limb was restricted to thetelencephalic region of forebrain.1 Publication

Inductioni

Induced by macrophage colony-stimulating factor in murine peritoneal and bone marrow macrophages.

Gene expression databases

BgeeiENSMUSG00000022043.
CleanExiMM_TRIM35.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Irf7P704342EBI-2536044,EBI-997907

Protein-protein interaction databases

BioGridi211764. 9 interactions.
IntActiQ8C006. 4 interactions.
STRINGi10090.ENSMUSP00000022623.

Structurei

3D structure databases

ProteinModelPortaliQ8C006.
SMRiQ8C006. Positions 4-87, 101-243, 302-491.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini284 – 495212B30.2/SPRYPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili200 – 25253Sequence analysisAdd
BLAST

Domaini

The RING finger domain and the coiled-coil region are required for the apoptosis-inducing activity.

Sequence similaritiesi

Belongs to the TRIM/RBCC family.Curated
Contains 1 B box-type zinc finger.PROSITE-ProRule annotation
Contains 1 B30.2/SPRY domain.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri21 – 6141RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri96 – 13742B box-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410KDQ6. Eukaryota.
ENOG410YB4K. LUCA.
HOVERGENiHBG098569.
InParanoidiQ8C006.
KOiK12012.
PhylomeDBiQ8C006.
TreeFamiTF334286.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013320. ConA-like_dom.
IPR006574. PRY.
IPR003877. SPRY_dom.
IPR027370. Znf-RING_LisH.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF00643. zf-B_box. 1 hit.
PF13445. zf-RING_UBOX. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00336. BBOX. 1 hit.
SM00589. PRY. 1 hit.
SM00184. RING. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8C006-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPGPSVSPG PSRSFKEELL CAVCYDPFRD AVTLRCGHNF CRRCVSGCWE
60 70 80 90 100
VQTTPSCPVC KERAVPGELR TNHTLNNLVE TLLREEAEGA RWTGRRSPRP
110 120 130 140 150
CRAHRAPLTL FCLEDKELLC CACQADARHQ EHRVQPIKDT AQDFRAKCKN
160 170 180 190 200
MEHVLREKAK AFWALRRTYE AIAKHNEVQT TWLEGRIRDE FDKLRDFLRV
210 220 230 240 250
EEQATLDAMK EESRKKHLQA EEKMKQLAEQ TEALAREIER LQMEMKEDDM
260 270 280 290 300
TFLMKHKSRK RRLFCTVEPA PLQPGLLMDA CKYLESLQYR VWKKMLGSVE
310 320 330 340 350
SVPFSLDPNT AAGWLKVADD LTSVINHGYR VQVENPERFS SAPCLLGSQV
360 370 380 390 400
FSKGSHSWEV DVGGLPTWRV GVVRVQAHAQ AQAQADVGGE GHSHSCYHDT
410 420 430 440 450
RSGFWYLCRT QGVDGDHCMT SDTATAPLVQ AMPRRLRVEL ECEEGELSFY
460 470 480 490 500
DSERHCHLYT FHAHFGEVRP YFYLGASRGD GPPEPLRICH LRVSIKEELD

I
Length:501
Mass (Da):57,345
Last modified:December 7, 2004 - v2
Checksum:i6EBDECF47FB5A528
GO
Isoform 2 (identifier: Q8C006-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-182: AKCKNMEHVLREKAKAFWALRRTYEAIAKHNEVQTTW → VSTAPARPGDPRLAPPPPPGLATILPPVQANLNNDGE
     183-501: Missing.

Note: No experimental confirmation available.
Show »
Length:182
Mass (Da):20,117
Checksum:iE7E65055949DBA77
GO

Sequence cautioni

The sequence AAI45784 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI45810 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB22506 differs from that shown. Reason: Frameshift at position 46. Curated
The sequence BAC27962 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC98098 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti207 – 2071D → Y in BAC36022 (PubMed:16141072).Curated
Sequence conflicti213 – 2131S → T in BAC36022 (PubMed:16141072).Curated
Sequence conflicti329 – 3291Y → H in BAB22506 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei146 – 18237AKCKN…VQTTW → VSTAPARPGDPRLAPPPPPG LATILPPVQANLNNDGE in isoform 2. 1 PublicationVSP_012062Add
BLAST
Alternative sequencei183 – 501319Missing in isoform 2. 1 PublicationVSP_019230Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB060155 mRNA. Translation: BAB83914.1.
AF145374 mRNA. Translation: AAN75731.1.
AF491350 Genomic DNA. Translation: AAO85477.1.
AK003000 mRNA. Translation: BAB22506.2. Frameshift.
AK032635 mRNA. Translation: BAC27962.1. Different initiation.
AK075877 mRNA. Translation: BAC36022.1.
AK129288 mRNA. Translation: BAC98098.1. Different initiation.
BC049105 mRNA. Translation: AAH49105.2.
BC053494 mRNA. Translation: AAH53494.1.
BC145783 mRNA. Translation: AAI45784.1. Different initiation.
BC145809 mRNA. Translation: AAI45810.1. Different initiation.
RefSeqiNP_084255.2. NM_029979.3.
UniGeneiMm.43871.

Genome annotation databases

GeneIDi66854.
KEGGimmu:66854.
UCSCiuc007ukd.1. mouse. [Q8C006-1]
uc007uke.1. mouse. [Q8C006-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB060155 mRNA. Translation: BAB83914.1.
AF145374 mRNA. Translation: AAN75731.1.
AF491350 Genomic DNA. Translation: AAO85477.1.
AK003000 mRNA. Translation: BAB22506.2. Frameshift.
AK032635 mRNA. Translation: BAC27962.1. Different initiation.
AK075877 mRNA. Translation: BAC36022.1.
AK129288 mRNA. Translation: BAC98098.1. Different initiation.
BC049105 mRNA. Translation: AAH49105.2.
BC053494 mRNA. Translation: AAH53494.1.
BC145783 mRNA. Translation: AAI45784.1. Different initiation.
BC145809 mRNA. Translation: AAI45810.1. Different initiation.
RefSeqiNP_084255.2. NM_029979.3.
UniGeneiMm.43871.

3D structure databases

ProteinModelPortaliQ8C006.
SMRiQ8C006. Positions 4-87, 101-243, 302-491.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi211764. 9 interactions.
IntActiQ8C006. 4 interactions.
STRINGi10090.ENSMUSP00000022623.

PTM databases

iPTMnetiQ8C006.
PhosphoSiteiQ8C006.

Proteomic databases

EPDiQ8C006.
MaxQBiQ8C006.
PaxDbiQ8C006.
PeptideAtlasiQ8C006.
PRIDEiQ8C006.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi66854.
KEGGimmu:66854.
UCSCiuc007ukd.1. mouse. [Q8C006-1]
uc007uke.1. mouse. [Q8C006-2]

Organism-specific databases

CTDi23087.
MGIiMGI:1914104. Trim35.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410KDQ6. Eukaryota.
ENOG410YB4K. LUCA.
HOVERGENiHBG098569.
InParanoidiQ8C006.
KOiK12012.
PhylomeDBiQ8C006.
TreeFamiTF334286.

Miscellaneous databases

PROiQ8C006.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022043.
CleanExiMM_TRIM35.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013320. ConA-like_dom.
IPR006574. PRY.
IPR003877. SPRY_dom.
IPR027370. Znf-RING_LisH.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
PF00643. zf-B_box. 1 hit.
PF13445. zf-RING_UBOX. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00336. BBOX. 1 hit.
SM00589. PRY. 1 hit.
SM00184. RING. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTRI35_MOUSE
AccessioniPrimary (citable) accession number: Q8C006
Secondary accession number(s): A6H681
, Q6ZPY0, Q7TQL7, Q810V7, Q8BVY9, Q8VID4, Q9CW74, Q9D208
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: September 7, 2016
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.