Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-dependent secretion activator 2

Gene

Cadps2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates neurotrophin release from granule cells leading to regulate cell differentiation and survival during cerebellar development. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles.

GO - Molecular functioni

GO - Biological processi

  • cellular response to starvation Source: MGI
  • positive regulation of exocytosis Source: MGI
  • protein transport Source: UniProtKB-KW
  • synaptic vesicle priming Source: MGI
Complete GO annotation...

Keywords - Biological processi

Exocytosis, Protein transport, Transport

Keywords - Ligandi

Calcium, Lipid-binding, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-dependent secretion activator 2
Alternative name(s):
Calcium-dependent activator protein for secretion 2
Short name:
CAPS-2
Gene namesi
Name:Cadps2
Synonyms:Caps2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2443963. Cadps2.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytoplasmic, membrane-bounded vesicle Source: MGI
  • cytoplasmic vesicle Source: MGI
  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • intracellular membrane-bounded organelle Source: MGI
  • nucleoplasm Source: MGI
  • postsynaptic membrane Source: MGI
  • presynaptic membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12971297Calcium-dependent secretion activator 2PRO_0000053869Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei61 – 611PhosphoserineCombined sources
Modified residuei1291 – 12911PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8BYR5.
PaxDbiQ8BYR5.
PRIDEiQ8BYR5.

PTM databases

iPTMnetiQ8BYR5.
PhosphoSiteiQ8BYR5.

Expressioni

Tissue specificityi

Highly expressed in cerebellum. Also expressed in non-neuronal tissues such as lung, spleen, testis, uterus and ovary. Highly expressed in brain. In brain, it is highly expressed in cerebellum, cortex, olfactory bulb, CA1/CA2 regions of the hippocampus, and dentate gyrus, and weakly or not expressed in the CA3 regions of the hippocampus, striatum, thalamus, superior and inferior colliculi, and brain stem. Not present in adult adrenal glands. Isoform 4, but not isoform 3, is highly expressed in postnatal and adult stages of cerebellum.2 Publications

Developmental stagei

Expressed at stable level during brain development, with a higher level in embryonic brain.

Gene expression databases

BgeeiQ8BYR5.
CleanExiMM_CADPS2.
MM_CAPS2.
ExpressionAtlasiQ8BYR5. baseline and differential.
GenevisibleiQ8BYR5. MM.

Interactioni

Subunit structurei

Homodimer. Interacts with the dopamine receptor DRD2 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Arf4P617502EBI-7569313,EBI-7569554
Arf5P840845EBI-7569313,EBI-7569461

Protein-protein interaction databases

IntActiQ8BYR5. 5 interactions.
MINTiMINT-8292694.
STRINGi10090.ENSMUSP00000018122.

Structurei

3D structure databases

ProteinModelPortaliQ8BYR5.
SMRiQ8BYR5. Positions 492-605.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini370 – 45182C2Add
BLAST
Domaini491 – 594104PHPROSITE-ProRule annotationAdd
BLAST
Domaini886 – 1057172MHD1PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni756 – 1075320Interaction with DRD2By similarityAdd
BLAST

Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids.By similarity

Sequence similaritiesi

Contains 1 C2 domain.Curated
Contains 1 MHD1 (MUNC13 homology domain 1) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
GeneTreeiENSGT00590000083094.
HOVERGENiHBG080678.
InParanoidiQ8BYR5.
KOiK19933.
OrthoDBiEOG7K0ZD0.
TreeFamiTF312963.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 1 hit.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BYR5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLDPSSSEEE SDEGLEEESR EVLVAPGVSQ RAPPAAAREG RRDAPGRSGG
60 70 80 90 100
GSGGGAARPV SPSPSVLSEG RNEPELQLDE EQERRIRLQL YVFVVRCIAY
110 120 130 140 150
PFNAKQPTDM ARRQQKLNKQ QLQLLKERFQ AFLNGETQIV ADEAFCNAVR
160 170 180 190 200
SYYEVFLKSD RVARMVQSGG CSANDFREVF KKNIEKRVRS LPEIDGLSKE
210 220 230 240 250
TVLSSWIAKY DAIYRGEEDL CKQPNRMTLS AVSELILSKE QLYEMFQQIL
260 270 280 290 300
GIKKLEHQLL YNACQLDNAD EQAAQIRREL DGRLQLAEKM AKERRFPRFI
310 320 330 340 350
SKEMESMYIE ELRASVNLLM ANLESLPVSK GGPEFKLQKL KRSQNSAFLD
360 370 380 390 400
LGDENEIQLS KSDVVLSFTL EIVIMEVQGL KSVAPNRIVY CTMEVEGGEK
410 420 430 440 450
LQTDQAEASR PQWGTQGDFN TTHPRPVVKV KLFTESTGVL ALEDKELGRV
460 470 480 490 500
VLYPTSNSSK SAELHRMTVP KNSQDSDLKI KLAVRMDKPA HMKHSGYLYA
510 520 530 540 550
LGQKVWKRWK KRYFVLVQVS QYTFAMCSYR EKKSEPQELM QLEGYTVDYT
560 570 580 590 600
DPHPGLQGGQ VFFNAVKEGD TVIFASDDEQ DRILWVQAMY RATGQSYKPV
610 620 630 640 650
PAVQSQKLNP KGGALHADAQ LYADRFQKHG MDEFISASPC KLDHAFLFRI
660 670 680 690 700
LQRQTLDHRL NDSYSCLGWF SPGQVFVLDE YCARYGVRGC HRHLCYLTEL
710 720 730 740 750
MEHSENGAVI DPTLLHYSFA FCASHVHGNR PDGIGTVSVE EKERFEEIKD
760 770 780 790 800
RLSSLLENQI SHFRYCFPFG RPEGALKATL SLLERVLMKD IATPIPAEEV
810 820 830 840 850
KKVVRKCLEK AALINYTRLT EYAKIEETMN QATPARKLEE VLHLAELCIE
860 870 880 890 900
VLQQNEEHHA EGREAFAWWP DLLAEHAEKF WALFTVDMDT ALEAQPQDSW
910 920 930 940 950
DSFPLFQLLN NFLRNDTLLC NGKFHKHLQE IFVPLVVRYV DLMESAIAQS
960 970 980 990 1000
IHRGFEQETW QPVKNIANSL PNVALPKVPS LPLNLPQIPS FSTPPWMASL
1010 1020 1030 1040 1050
YESTNGSTTS EDLFWKLDAL QMFVFDLHWP EQEFAHHLEQ RLKLMASDMI
1060 1070 1080 1090 1100
EACVKRTRTA FELKLQKANK TTDLRIPASV CTMFNVLVDA KKQSTKLCAL
1110 1120 1130 1140 1150
DGGQEQQYHS KIDDLIDNTV KEIIALLVSK FVSVLEGVLS KLSRYDEGTF
1160 1170 1180 1190 1200
FSSILSFTVK AAAKYVDVPK PGMDLADTYI MFVRQNQDIL REKVNEEMYI
1210 1220 1230 1240 1250
EKLFDQWYSN SMKVICVWLA DRLDLQLHIY QLKTLIKIVK KTYRDFRLQG
1260 1270 1280 1290
VLEGTLNSKT YDTLHRRLTV EEATASVSEG GGLQGITMKD SDEEEEG
Length:1,297
Mass (Da):147,841
Last modified:January 10, 2006 - v2
Checksum:i34220B10B4429D58
GO
Isoform 2 (identifier: Q8BYR5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-826: E → EGPAEKET

Show »
Length:1,304
Mass (Da):148,553
Checksum:i1F0D3254F416E062
GO
Isoform 3 (identifier: Q8BYR5-3) [UniParc]FASTAAdd to basket

Also known as: CAPS2b

The sequence of this isoform differs from the canonical sequence as follows:
     26-55: PGVSQRAPPAAAREGRRDAPGRSGGGSGGG → R
     826-826: E → EGPAEKET

Show »
Length:1,275
Mass (Da):145,939
Checksum:i77B46E2B0891FD37
GO
Isoform 4 (identifier: Q8BYR5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-826: E → EGPAEKET
     964-1004: KNIANSLPNVALPKVPSLPLNLPQIPSFSTPPWMASLYEST → N

Show »
Length:1,264
Mass (Da):144,251
Checksum:i1889D4B8E1FD0E10
GO
Isoform 5 (identifier: Q8BYR5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     861-863: Missing.
     964-1004: KNIANSLPNVALPKVPSLPLNLPQIPSFSTPPWMASLYEST → N
     1105-1105: E → EFRNQW

Show »
Length:1,259
Mass (Da):143,928
Checksum:iAAE420C17BCDDE49
GO
Isoform 6 (identifier: Q8BYR5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     731-768: PDGIGTVSVE...QISHFRYCFP → FLSFFFFFFF...TQRSEHPDSN
     769-1297: Missing.

Show »
Length:768
Mass (Da):87,464
Checksum:i97349220BD09B26C
GO
Isoform 7 (identifier: Q8BYR5-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-173: FLKSDRVARMVQSGGCSA → SLQSCFGTVVLSKTISLV
     174-1297: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,057
Checksum:iEAB0F96B45F41CCB
GO

Sequence cautioni

The sequence AAB58720.2 differs from that shown. Reason: Frameshift at positions 220, 237, 1288 and 1297. Curated
Isoform 6 : The sequence AAH55462.1 differs from that shown. Reason: Frameshift at position 739. Curated
The sequence AAH59274.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti99 – 991A → V in BAC30047 (PubMed:16141072).Curated
Sequence conflicti106 – 1061Q → H in BAC30047 (PubMed:16141072).Curated
Sequence conflicti133 – 1342LN → SQ in AAL67937 (PubMed:12659812).Curated
Sequence conflicti162 – 1621V → M in BAC32801 (PubMed:16141072).Curated
Sequence conflicti411 – 4122PQ → AK in AAB58720 (Ref. 4) Curated
Sequence conflicti493 – 4931K → E in AAB58720 (Ref. 4) Curated
Sequence conflicti517 – 5171V → E in AAB58720 (Ref. 4) Curated
Sequence conflicti684 – 6841R → P in AAB58720 (Ref. 4) Curated
Sequence conflicti690 – 6901C → F in AAB58720 (Ref. 4) Curated
Sequence conflicti702 – 7021E → G in AAB58720 (Ref. 4) Curated
Sequence conflicti1073 – 10731D → N in AAB58720 (Ref. 4) Curated
Sequence conflicti1292 – 12921D → E in AAH59274 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei26 – 5530PGVSQ…GSGGG → R in isoform 3. 1 PublicationVSP_016819Add
BLAST
Alternative sequencei156 – 17318FLKSD…GGCSA → SLQSCFGTVVLSKTISLV in isoform 7. 1 PublicationVSP_016820Add
BLAST
Alternative sequencei174 – 12971124Missing in isoform 7. 1 PublicationVSP_016821Add
BLAST
Alternative sequencei731 – 76838PDGIG…RYCFP → FLSFFFFFFFPQSCVSFRLF TEWQSVEGTQRSEHPDSN in isoform 6. 2 PublicationsVSP_016822Add
BLAST
Alternative sequencei769 – 1297529Missing in isoform 6. 2 PublicationsVSP_016823Add
BLAST
Alternative sequencei826 – 8261E → EGPAEKET in isoform 2, isoform 3 and isoform 4. 5 PublicationsVSP_016824
Alternative sequencei861 – 8633Missing in isoform 5. 1 PublicationVSP_016825
Alternative sequencei964 – 100441KNIAN…LYEST → N in isoform 4 and isoform 5. 2 PublicationsVSP_016826Add
BLAST
Alternative sequencei1105 – 11051E → EFRNQW in isoform 5. 1 PublicationVSP_016827

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072800 mRNA. Translation: AAL67937.1.
AB098623 mRNA. Translation: BAD05017.1.
AK038568 mRNA. Translation: BAC30047.1.
AK042634 mRNA. Translation: BAC31314.1.
AK046596 mRNA. Translation: BAC32801.1.
AF000969 mRNA. Translation: AAB58720.2. Frameshift.
BC047394 mRNA. Translation: AAH47394.1.
BC055462 mRNA. Translation: AAH55462.1. Frameshift.
BC059274 mRNA. Translation: AAH59274.1. Different initiation.
BC080854 mRNA. Translation: AAH80854.1.
CCDSiCCDS39439.1. [Q8BYR5-2]
CCDS57411.1. [Q8BYR5-5]
CCDS57412.1. [Q8BYR5-4]
CCDS57413.1. [Q8BYR5-6]
RefSeqiNP_001239034.1. NM_001252105.1. [Q8BYR5-4]
XP_006505175.1. XM_006505112.1. [Q8BYR5-1]
UniGeneiMm.259632.

Genome annotation databases

EnsembliENSMUST00000018122; ENSMUSP00000018122; ENSMUSG00000017978. [Q8BYR5-2]
ENSMUST00000115356; ENSMUSP00000111013; ENSMUSG00000017978. [Q8BYR5-6]
ENSMUST00000115358; ENSMUSP00000111015; ENSMUSG00000017978. [Q8BYR5-4]
ENSMUST00000115361; ENSMUSP00000111018; ENSMUSG00000017978. [Q8BYR5-5]
GeneIDi320405.
KEGGimmu:320405.
UCSCiuc009bbe.2. mouse. [Q8BYR5-4]
uc009bbg.2. mouse. [Q8BYR5-5]
uc009bbh.3. mouse. [Q8BYR5-6]
uc009bbm.2. mouse. [Q8BYR5-7]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072800 mRNA. Translation: AAL67937.1.
AB098623 mRNA. Translation: BAD05017.1.
AK038568 mRNA. Translation: BAC30047.1.
AK042634 mRNA. Translation: BAC31314.1.
AK046596 mRNA. Translation: BAC32801.1.
AF000969 mRNA. Translation: AAB58720.2. Frameshift.
BC047394 mRNA. Translation: AAH47394.1.
BC055462 mRNA. Translation: AAH55462.1. Frameshift.
BC059274 mRNA. Translation: AAH59274.1. Different initiation.
BC080854 mRNA. Translation: AAH80854.1.
CCDSiCCDS39439.1. [Q8BYR5-2]
CCDS57411.1. [Q8BYR5-5]
CCDS57412.1. [Q8BYR5-4]
CCDS57413.1. [Q8BYR5-6]
RefSeqiNP_001239034.1. NM_001252105.1. [Q8BYR5-4]
XP_006505175.1. XM_006505112.1. [Q8BYR5-1]
UniGeneiMm.259632.

3D structure databases

ProteinModelPortaliQ8BYR5.
SMRiQ8BYR5. Positions 492-605.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BYR5. 5 interactions.
MINTiMINT-8292694.
STRINGi10090.ENSMUSP00000018122.

PTM databases

iPTMnetiQ8BYR5.
PhosphoSiteiQ8BYR5.

Proteomic databases

MaxQBiQ8BYR5.
PaxDbiQ8BYR5.
PRIDEiQ8BYR5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000018122; ENSMUSP00000018122; ENSMUSG00000017978. [Q8BYR5-2]
ENSMUST00000115356; ENSMUSP00000111013; ENSMUSG00000017978. [Q8BYR5-6]
ENSMUST00000115358; ENSMUSP00000111015; ENSMUSG00000017978. [Q8BYR5-4]
ENSMUST00000115361; ENSMUSP00000111018; ENSMUSG00000017978. [Q8BYR5-5]
GeneIDi320405.
KEGGimmu:320405.
UCSCiuc009bbe.2. mouse. [Q8BYR5-4]
uc009bbg.2. mouse. [Q8BYR5-5]
uc009bbh.3. mouse. [Q8BYR5-6]
uc009bbm.2. mouse. [Q8BYR5-7]

Organism-specific databases

CTDi93664.
MGIiMGI:2443963. Cadps2.

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
GeneTreeiENSGT00590000083094.
HOVERGENiHBG080678.
InParanoidiQ8BYR5.
KOiK19933.
OrthoDBiEOG7K0ZD0.
TreeFamiTF312963.

Miscellaneous databases

PROiQ8BYR5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BYR5.
CleanExiMM_CADPS2.
MM_CAPS2.
ExpressionAtlasiQ8BYR5. baseline and differential.
GenevisibleiQ8BYR5. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 1 hit.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of human CADPS and CADPS2, new members of the Ca2+-dependent activator for secretion protein family."
    Cisternas F.A., Vincent J.B., Scherer S.W., Ray P.N.
    Genomics 81:279-291(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. "The secretory granule-associated protein CAPS2 regulates neurotrophin release and cell survival."
    Sadakata T., Mizoguchi A., Sato Y., Katoh-Semba R., Fukuda M., Mikoshiba K., Furuichi T.
    J. Neurosci. 24:43-52(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 6 AND 7).
    Strain: C57BL/6J.
    Tissue: Adipose tissue and Hypothalamus.
  4. "Differentially expressed mRNA in mouse cerebellum during postnatal development."
    Radrizzani M., Cafferata E., Vila-Ortiz G., Costanzo R.V., Ortega M.J., Gonzalez-Guerrico A., Di Tella M., Pivetta O., Carminatti H., Santa-Coloma T.
    Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-1297 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 31-1297 (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 136-1297 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-1297 (ISOFORM 6).
    Strain: Czech II and FVB/N.
    Tissue: Mammary tumor and Salivary gland.
  6. "A family of Ca2+-dependent activator proteins for secretion: comparative analysis of structure, expression, localization, and function."
    Speidel D., Varoqueaux F., Enk C., Nojiri M., Grishanin R.N., Martin T.F.J., Hofmann K., Brose N., Reim K.
    J. Biol. Chem. 278:52802-52809(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  7. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-61 AND SER-1291, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney and Pancreas.

Entry informationi

Entry nameiCAPS2_MOUSE
AccessioniPrimary (citable) accession number: Q8BYR5
Secondary accession number(s): O08903
, Q66JM7, Q6PCL7, Q76I88, Q7TMM6, Q80ZV8, Q8BL25, Q8BY04, Q8K3K6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: June 8, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.