Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphatase and actin regulator 3

Gene

Phactr3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Protein phosphatase inhibitor

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatase and actin regulator 3
Alternative name(s):
Scaffold-associated PP1-inhibiting protein
Short name:
Scapinin
Gene namesi
Name:Phactr3
Synonyms:Scapin1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1921439. Phactr3.

Subcellular locationi

  • Nucleus matrix By similarity

  • Note: Localized to the nuclear matrix-intermediate filament scaffold.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 558558Phosphatase and actin regulator 3PRO_0000126639Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei69 – 691PhosphothreonineBy similarity
Modified residuei229 – 2291PhosphoserineCombined sources
Modified residuei235 – 2351PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8BYK5.
PaxDbiQ8BYK5.
PRIDEiQ8BYK5.

PTM databases

iPTMnetiQ8BYK5.
PhosphoSiteiQ8BYK5.

Expressioni

Gene expression databases

BgeeiQ8BYK5.
CleanExiMM_PHACTR3.
ExpressionAtlasiQ8BYK5. baseline and differential.
GenevisibleiQ8BYK5. MM.

Interactioni

Subunit structurei

Binds PPP1CA and actin; thus inhibiting the protein phosphatase 1 (PP1) activity.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000104543.

Structurei

3D structure databases

ProteinModelPortaliQ8BYK5.
SMRiQ8BYK5. Positions 402-506.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati92 – 11726RPEL 1Add
BLAST
Repeati400 – 42526RPEL 2Add
BLAST
Repeati438 – 46326RPEL 3Add
BLAST
Repeati476 – 50126RPEL 4Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili449 – 48537Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi216 – 23823Pro-richAdd
BLAST

Sequence similaritiesi

Contains 4 RPEL repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG4339. Eukaryota.
ENOG4111M01. LUCA.
GeneTreeiENSGT00390000004420.
HOGENOMiHOG000220879.
HOVERGENiHBG057352.
InParanoidiQ8BYK5.
KOiK17594.
OMAiDAESKTC.
TreeFamiTF316316.

Family and domain databases

InterProiIPR029990. Phactr3.
IPR004018. RPEL_repeat.
[Graphical view]
PANTHERiPTHR12751:SF7. PTHR12751:SF7. 1 hit.
PfamiPF02755. RPEL. 1 hit.
[Graphical view]
SMARTiSM00707. RPEL. 4 hits.
[Graphical view]
PROSITEiPS51073. RPEL. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BYK5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAASEDGSSC LVSRGRSQSD PSFLSDSSAT STDAGENPDE MDQTPPARSE
60 70 80 90 100
PLVSGIRTPP VRRNSKLATL GRIFKPWKWR KKKNEKLKQT TSALEKKMAG
110 120 130 140 150
RQGREELIKQ GLLEMMEQDS ENKACSPKEG SQPVQSEPPA GEQETLTSEG
160 170 180 190 200
AQPGSPSASG TDQVSQDELL SSDAHLDDTA NIPSASTAEE ADAGSLLPTT
210 220 230 240 250
DEPSQALAGS DSLDSPPRSL ERSVSQLPSP PLLPTPPPKA SSKATKNVTG
260 270 280 290 300
QAALFQGPSM KNNEPALRGQ LATPTGSPHV TTVHRPLPPS RVMEELHRAL
310 320 330 340 350
ATKHRQDSFQ GRECRGSPKK RMDVRLSRTS SMERGKERDE AWSFDGASEN
360 370 380 390 400
KWTATKDSEE NKENLMLSSE LKDDMLLYQD EEALNDSIIS GTLPRKCKKE
410 420 430 440 450
LLAVKLRNRP SKQELEDRNI FPRRTDEERQ EIRQQIEMKL SKRLSQRPAV
460 470 480 490 500
EELERRNILK QRNDQTEQEE RREIKQRLTR KLNQRPTVDE LRDRKILIRF
510 520 530 540 550
SDYVEVARAQ DYDRRADKPW TRLSAADKAA IRKELNEYKS NEMEVHASSK

HLTRFHRP
Length:558
Mass (Da):62,652
Last modified:November 28, 2003 - v2
Checksum:i8D7D1D5F5BEE37A9
GO
Isoform 2 (identifier: Q8BYK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAASEDGSSC...ATSTDAGENP → MQTANQMLSL...PPGSGPSRCG

Show »
Length:559
Mass (Da):63,130
Checksum:i7A0191C5DB3A59CF
GO
Isoform 3 (identifier: Q8BYK5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAASEDGSSCLVSRGRSQSDPSFLSDSSATSTDAGENP → MRGQGRGHARWPAPLRSLLRAFGPQDTTTGGLEQ

Show »
Length:554
Mass (Da):62,563
Checksum:iEE98DF913E41D1E0
GO
Isoform 4 (identifier: Q8BYK5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Show »
Length:518
Mass (Da):58,618
Checksum:iA1B24FD62E5DCD58
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4040Missing in isoform 4. 1 PublicationVSP_009095Add
BLAST
Alternative sequencei1 – 3838MAASE…AGENP → MQTANQMLSLNFRRMKSGTA AVRTRARHRPPGSGPSRCG in isoform 2. 1 PublicationVSP_009093Add
BLAST
Alternative sequencei1 – 3838MAASE…AGENP → MRGQGRGHARWPAPLRSLLR AFGPQDTTTGGLEQ in isoform 3. 1 PublicationVSP_009094Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY501387 mRNA. Translation: AAS86433.1.
AK005136 mRNA. Translation: BAB23834.1.
AK032242 mRNA. Translation: BAC27776.1.
AK038449 mRNA. Translation: BAC30003.1.
AK039213 mRNA. Translation: BAC30278.1.
BC058621 mRNA. Translation: AAH58621.1.
BC059869 mRNA. Translation: AAH59869.1.
CCDSiCCDS17158.1. [Q8BYK5-1]
CCDS17159.1. [Q8BYK5-4]
CCDS50837.1. [Q8BYK5-3]
CCDS50839.1. [Q8BYK5-2]
RefSeqiNP_001007155.1. NM_001007154.3. [Q8BYK5-4]
NP_001171260.1. NM_001177789.1. [Q8BYK5-3]
NP_001171261.1. NM_001177790.1.
NP_001171262.1. NM_001177791.1. [Q8BYK5-2]
NP_083082.1. NM_028806.2. [Q8BYK5-1]
XP_006500793.1. XM_006500730.1. [Q8BYK5-4]
UniGeneiMm.44413.

Genome annotation databases

EnsembliENSMUST00000103065; ENSMUSP00000099354; ENSMUSG00000027525. [Q8BYK5-4]
ENSMUST00000103066; ENSMUSP00000099355; ENSMUSG00000027525. [Q8BYK5-1]
ENSMUST00000108915; ENSMUSP00000104543; ENSMUSG00000027525. [Q8BYK5-2]
ENSMUST00000108916; ENSMUSP00000104544; ENSMUSG00000027525. [Q8BYK5-3]
GeneIDi74189.
KEGGimmu:74189.
UCSCiuc008ohj.2. mouse. [Q8BYK5-3]
uc008ohk.2. mouse. [Q8BYK5-1]
uc008ohl.2. mouse. [Q8BYK5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY501387 mRNA. Translation: AAS86433.1.
AK005136 mRNA. Translation: BAB23834.1.
AK032242 mRNA. Translation: BAC27776.1.
AK038449 mRNA. Translation: BAC30003.1.
AK039213 mRNA. Translation: BAC30278.1.
BC058621 mRNA. Translation: AAH58621.1.
BC059869 mRNA. Translation: AAH59869.1.
CCDSiCCDS17158.1. [Q8BYK5-1]
CCDS17159.1. [Q8BYK5-4]
CCDS50837.1. [Q8BYK5-3]
CCDS50839.1. [Q8BYK5-2]
RefSeqiNP_001007155.1. NM_001007154.3. [Q8BYK5-4]
NP_001171260.1. NM_001177789.1. [Q8BYK5-3]
NP_001171261.1. NM_001177790.1.
NP_001171262.1. NM_001177791.1. [Q8BYK5-2]
NP_083082.1. NM_028806.2. [Q8BYK5-1]
XP_006500793.1. XM_006500730.1. [Q8BYK5-4]
UniGeneiMm.44413.

3D structure databases

ProteinModelPortaliQ8BYK5.
SMRiQ8BYK5. Positions 402-506.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000104543.

PTM databases

iPTMnetiQ8BYK5.
PhosphoSiteiQ8BYK5.

Proteomic databases

MaxQBiQ8BYK5.
PaxDbiQ8BYK5.
PRIDEiQ8BYK5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000103065; ENSMUSP00000099354; ENSMUSG00000027525. [Q8BYK5-4]
ENSMUST00000103066; ENSMUSP00000099355; ENSMUSG00000027525. [Q8BYK5-1]
ENSMUST00000108915; ENSMUSP00000104543; ENSMUSG00000027525. [Q8BYK5-2]
ENSMUST00000108916; ENSMUSP00000104544; ENSMUSG00000027525. [Q8BYK5-3]
GeneIDi74189.
KEGGimmu:74189.
UCSCiuc008ohj.2. mouse. [Q8BYK5-3]
uc008ohk.2. mouse. [Q8BYK5-1]
uc008ohl.2. mouse. [Q8BYK5-2]

Organism-specific databases

CTDi116154.
MGIiMGI:1921439. Phactr3.

Phylogenomic databases

eggNOGiKOG4339. Eukaryota.
ENOG4111M01. LUCA.
GeneTreeiENSGT00390000004420.
HOGENOMiHOG000220879.
HOVERGENiHBG057352.
InParanoidiQ8BYK5.
KOiK17594.
OMAiDAESKTC.
TreeFamiTF316316.

Miscellaneous databases

NextBioi340044.
PROiQ8BYK5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BYK5.
CleanExiMM_PHACTR3.
ExpressionAtlasiQ8BYK5. baseline and differential.
GenevisibleiQ8BYK5. MM.

Family and domain databases

InterProiIPR029990. Phactr3.
IPR004018. RPEL_repeat.
[Graphical view]
PANTHERiPTHR12751:SF7. PTHR12751:SF7. 1 hit.
PfamiPF02755. RPEL. 1 hit.
[Graphical view]
SMARTiSM00707. RPEL. 4 hits.
[Graphical view]
PROSITEiPS51073. RPEL. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Phactrs 1-4: a family of protein phosphatase 1 and actin regulatory proteins."
    Allen P.B., Greenfield A.T., Svenningsson P., Haspeslagh D.C., Greengard P.
    Proc. Natl. Acad. Sci. U.S.A. 101:7187-7192(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH PPP1CA AND ACTIN.
    Strain: C57BL/6J.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Cerebellum, Hypothalamus and Olfactory bulb.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229 AND THR-235, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiPHAR3_MOUSE
AccessioniPrimary (citable) accession number: Q8BYK5
Secondary accession number(s): Q8BYS8, Q8C058, Q9DB87
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2003
Last sequence update: November 28, 2003
Last modified: January 20, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.