Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat and fibronectin type-III domain-containing protein 5

Gene

Lrfn5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell adhesion molecule that mediates homophilic cell-cell adhesion in a Ca2+-independent manner. Promotes neurite outgrowth in hippocampal neurons (By similarity).By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat and fibronectin type-III domain-containing protein 5
Gene namesi
Name:Lrfn5
Synonyms:Kiaa4208, Salm5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:2144814. Lrfn5.

Subcellular locationi

  • Membrane 1 Publication; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini18 – 529ExtracellularSequence analysisAdd BLAST512
Transmembranei530 – 550HelicalSequence analysisAdd BLAST21
Topological domaini551 – 719CytoplasmicSequence analysisAdd BLAST169

GO - Cellular componenti

  • cell surface Source: MGI
  • integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 17Sequence analysisAdd BLAST17
ChainiPRO_000001484618 – 719Leucine-rich repeat and fibronectin type-III domain-containing protein 5Add BLAST702

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi73N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi308 ↔ 357PROSITE-ProRule annotation
Glycosylationi330N-linked (GlcNAc...)Sequence analysis1
Glycosylationi339N-linked (GlcNAc...)Sequence analysis1
Glycosylationi382N-linked (GlcNAc...)Sequence analysis1
Glycosylationi406N-linked (GlcNAc...)Sequence analysis1
Glycosylationi452N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

Glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8BXA0.
PeptideAtlasiQ8BXA0.
PRIDEiQ8BXA0.

PTM databases

iPTMnetiQ8BXA0.
PhosphoSitePlusiQ8BXA0.

Expressioni

Tissue specificityi

Predominantly expressed in the brain, with a weak, but broad expression in the cerebral cortex and diencephalic nuclei. Strongly expressed in both the pyramidal layer and the dentate gyrus of the hippocampus. Also detected in other parts of the central nervous system, including the olfactory bulb, pons, cerebellum, and medulla oblongata, as well as in the peripheral nervous system, such as the ganglia of cranial nerves and the dorsal root ganglion during gestation.1 Publication

Developmental stagei

Expression starts around 11.5-12.5 dpc. At 11.5 dpc, detected in the outer layer of the telencephalic vesicles. This pattern of expression continues until 17.5 dpc with expression in the cortical plate, but not in the inner layer of the cerebral cortex, including subplate, ventricular zone, and subventricular zone. As also detected in the hippocampus, amygdala and widely in diencephalic nuclei.1 Publication

Gene expression databases

BgeeiENSMUSG00000035653.
GenevisibleiQ8BXA0. MM.

Interactioni

Subunit structurei

Can form heteromeric complexes with LRFN1, LRFN2, LRFN3 and LFRN4 (By similarity). Able to form homomeric complexes across cell junctions, between adjacent cells (By similarity). Does not interact with DLG1, DLG2 or DLG3 (By similarity). Does not interact with DLG4.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000051546.

Structurei

3D structure databases

ProteinModelPortaliQ8BXA0.
SMRiQ8BXA0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 51LRRNTAdd BLAST34
Repeati52 – 73LRR 1Add BLAST22
Repeati76 – 97LRR 2Add BLAST22
Repeati100 – 121LRR 3Add BLAST22
Repeati124 – 145LRR 4Add BLAST22
Repeati148 – 169LRR 5Add BLAST22
Repeati172 – 193LRR 6Add BLAST22
Repeati196 – 217LRR 7Add BLAST22
Domaini240 – 286LRRCTAdd BLAST47
Domaini287 – 373Ig-likeAdd BLAST87
Domaini414 – 503Fibronectin type-IIIAdd BLAST90

Domaini

Lacks a cytoplasmic PDZ-binding motif, which has been implicated in function of related LRFN proteins.

Sequence similaritiesi

Belongs to the LRFN family.Curated
Contains 1 fibronectin type-III domain.Curated
Contains 7 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00760000118831.
HOGENOMiHOG000237343.
HOVERGENiHBG052352.
InParanoidiQ8BXA0.
KOiK16358.
OMAiTNVESQN.
OrthoDBiEOG091G01R2.
PhylomeDBiQ8BXA0.
TreeFamiTF350185.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR026879. Lrfn5.
IPR026906. LRR_5.
[Graphical view]
PANTHERiPTHR24373:SF3. PTHR24373:SF3. 1 hit.
PfamiPF07679. I-set. 1 hit.
PF13306. LRR_5. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00369. LRR_TYP. 6 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
SSF49265. SSF49265. 1 hit.
SSF52058. SSF52058. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BXA0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKFLFYLFL IGIAVRAQIC PKRCVCQILS PNLATLCAKK GLLFVPPNID
60 70 80 90 100
RRTVELRLAD NFVTNIKRKD FANMTSLVDL TLSRNTISFI TPHAFADLRN
110 120 130 140 150
LRALHLNSNR LTKITNDMFS GLSNLHHLIL NNNQLTLISS TAFDDVFALE
160 170 180 190 200
ELDLSYNNLE TIPWDAVEKM VSLHTLSLDH NMIDNIPKGT FSHLHKMTRL
210 220 230 240 250
DVTSNKLQKL PPDPLFQRAQ VLATSGIISP STFALSFGGN PLHCNCELLW
260 270 280 290 300
LRRLSREDDL ETCASPALLT GRYFWSIPEE EFLCEPPLIT RHTHEMRVLE
310 320 330 340 350
GQRATLRCKA RGDPEPAIHW ISPEGKLISN ATRSLVYDNG TLDILITTVK
360 370 380 390 400
DTGAFTCIAS NPAGEATQTV DLHIIKLPHL LNSTNHIHEP DPGSSDISTS
410 420 430 440 450
TKSGSNASSS NGDTKMSQDK IVVAEATSST ALLKFNFQRN IPGIRMFQIQ
460 470 480 490 500
YNGTYDDTLV YRMIPPTSKT FLVNNLASGT MYDLCVLAIY DDGITSLTAT
510 520 530 540 550
RVVGCIQFTT EQDYVRCHFM QSQFLGGTMI IIIGGIIVAS VLVFIIILMI
560 570 580 590 600
RYKVCNNNGQ HKVTKVSNVY SQTNGAQMQG CSVTLPQSMS KQAMGHEENA
610 620 630 640 650
QCCKVASDNA IQSSETCSSQ DSSTTTSALP PTWTSSAPVS QKQKRKTGTK
660 670 680 690 700
PSAEPQSEAV TNVESQNTNR NNSTALQLAS CPPDSVTEGP TSQRAHTKPN
710
ALLTNVDQNV QETQRLESI
Length:719
Mass (Da):79,371
Last modified:March 1, 2003 - v1
Checksum:iDCA5D8C68F7D6FEC
GO
Isoform 2 (identifier: Q8BXA0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     700-719: NALLTNVDQNVQETQRLESI → SKFLTVPAEGSRARHRASLSGGLKDSFHYGNSQLSLKRSMSMNAMWT

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:746
Mass (Da):82,286
Checksum:i00AA4767BA19908E
GO

Sequence cautioni

The sequence BAD90535 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009299700 – 719NALLT…RLESI → SKFLTVPAEGSRARHRASLS GGLKDSFHYGNSQLSLKRSM SMNAMWT in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034245 mRNA. Translation: BAC28645.1.
AK048443 mRNA. Translation: BAC33339.1.
AK220546 mRNA. Translation: BAD90535.1. Different initiation.
BC052038 mRNA. Translation: AAH52038.1.
CCDSiCCDS25936.1. [Q8BXA0-2]
CCDS79117.1. [Q8BXA0-1]
RefSeqiNP_001297515.1. NM_001310586.1. [Q8BXA0-1]
NP_848829.2. NM_178714.5. [Q8BXA0-2]
XP_006515893.1. XM_006515830.2. [Q8BXA0-2]
XP_006515894.1. XM_006515831.3. [Q8BXA0-2]
XP_017170545.1. XM_017315056.1. [Q8BXA0-1]
UniGeneiMm.28802.

Genome annotation databases

EnsembliENSMUST00000055815; ENSMUSP00000051546; ENSMUSG00000035653. [Q8BXA0-2]
ENSMUST00000119481; ENSMUSP00000113123; ENSMUSG00000035653. [Q8BXA0-1]
GeneIDi238205.
KEGGimmu:238205.
UCSCiuc007nqm.1. mouse. [Q8BXA0-2]
uc007nqn.1. mouse. [Q8BXA0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034245 mRNA. Translation: BAC28645.1.
AK048443 mRNA. Translation: BAC33339.1.
AK220546 mRNA. Translation: BAD90535.1. Different initiation.
BC052038 mRNA. Translation: AAH52038.1.
CCDSiCCDS25936.1. [Q8BXA0-2]
CCDS79117.1. [Q8BXA0-1]
RefSeqiNP_001297515.1. NM_001310586.1. [Q8BXA0-1]
NP_848829.2. NM_178714.5. [Q8BXA0-2]
XP_006515893.1. XM_006515830.2. [Q8BXA0-2]
XP_006515894.1. XM_006515831.3. [Q8BXA0-2]
XP_017170545.1. XM_017315056.1. [Q8BXA0-1]
UniGeneiMm.28802.

3D structure databases

ProteinModelPortaliQ8BXA0.
SMRiQ8BXA0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000051546.

PTM databases

iPTMnetiQ8BXA0.
PhosphoSitePlusiQ8BXA0.

Proteomic databases

PaxDbiQ8BXA0.
PeptideAtlasiQ8BXA0.
PRIDEiQ8BXA0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000055815; ENSMUSP00000051546; ENSMUSG00000035653. [Q8BXA0-2]
ENSMUST00000119481; ENSMUSP00000113123; ENSMUSG00000035653. [Q8BXA0-1]
GeneIDi238205.
KEGGimmu:238205.
UCSCiuc007nqm.1. mouse. [Q8BXA0-2]
uc007nqn.1. mouse. [Q8BXA0-1]

Organism-specific databases

CTDi145581.
MGIiMGI:2144814. Lrfn5.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00760000118831.
HOGENOMiHOG000237343.
HOVERGENiHBG052352.
InParanoidiQ8BXA0.
KOiK16358.
OMAiTNVESQN.
OrthoDBiEOG091G01R2.
PhylomeDBiQ8BXA0.
TreeFamiTF350185.

Miscellaneous databases

PROiQ8BXA0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000035653.
GenevisibleiQ8BXA0. MM.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR026879. Lrfn5.
IPR026906. LRR_5.
[Graphical view]
PANTHERiPTHR24373:SF3. PTHR24373:SF3. 1 hit.
PfamiPF07679. I-set. 1 hit.
PF13306. LRR_5. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00369. LRR_TYP. 6 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
SSF49265. SSF49265. 1 hit.
SSF52058. SSF52058. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 6 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLRFN5_MOUSE
AccessioniPrimary (citable) accession number: Q8BXA0
Secondary accession number(s): Q5DTH4, Q8BJH4, Q8BZL0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: March 1, 2003
Last modified: November 30, 2016
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.