Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-alpha-acetyltransferase 25, NatB auxiliary subunit

Gene

Naa25

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Non-catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
N-alpha-acetyltransferase 25, NatB auxiliary subunit
Alternative name(s):
Mitochondrial distribution and morphology protein 20
N-terminal acetyltransferase B complex subunit MDM20
Short name:
NatB complex subunit MDM20
N-terminal acetyltransferase B complex subunit NAA25
Gene namesi
Name:Naa25
Synonyms:Mdm20
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2442563. Naa25.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 972972N-alpha-acetyltransferase 25, NatB auxiliary subunitPRO_0000294338Add
BLAST

Proteomic databases

EPDiQ8BWZ3.
MaxQBiQ8BWZ3.
PaxDbiQ8BWZ3.
PRIDEiQ8BWZ3.

PTM databases

iPTMnetiQ8BWZ3.
PhosphoSiteiQ8BWZ3.

Expressioni

Gene expression databases

BgeeiQ8BWZ3.
CleanExiMM_C330023M02RIK.
ExpressionAtlasiQ8BWZ3. baseline and differential.
GenevisibleiQ8BWZ3. MM.

Interactioni

Subunit structurei

Component of the N-terminal acetyltransferase B (NatB) complex which is composed of NAA20 and NAA25.By similarity

Protein-protein interaction databases

BioGridi231159. 1 interaction.
IntActiQ8BWZ3. 1 interaction.
STRINGi10090.ENSMUSP00000038977.

Structurei

3D structure databases

ProteinModelPortaliQ8BWZ3.
SMRiQ8BWZ3. Positions 30-147.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati11 – 4434TPR 1Add
BLAST
Repeati45 – 7834TPR 2Add
BLAST
Repeati79 – 11234TPR 3Add
BLAST
Repeati114 – 14633TPR 4Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi871 – 8777Poly-Lys

Sequence similaritiesi

Belongs to the MDM20/NAA25 family.Curated
Contains 4 TPR repeats.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG2053. Eukaryota.
ENOG410XRXD. LUCA.
GeneTreeiENSGT00390000003496.
HOGENOMiHOG000060132.
InParanoidiQ8BWZ3.
KOiK17973.
OMAiMGPSDPY.
OrthoDBiEOG75F4CR.
PhylomeDBiQ8BWZ3.
TreeFamiTF315103.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR019183. N-acetylTrfase_B_cplx_non-cat.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF09797. NatB_MDM20. 1 hit.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.
PROSITEiPS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BWZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATRGHVQDP NDRRLRPIYD YLDNGNNKMA IQQADKLLKK HKDLHCAKVL
60 70 80 90 100
KAIGLQRTGK QEEAFTLAQE VAALEPTDDN SLQALTILYR EMHRPELVTK
110 120 130 140 150
LYEAAVKKVP NSEEYHSHLF MAYARVGEYK KMQQAGMALY KIVPKNPYYF
160 170 180 190 200
WSVMSLIMQS ISARDENLSK TMFLPLAERM VEKMVKEDKI EAEAEVELYY
210 220 230 240 250
MILERLGKYQ EALDVIRGKL GEKLTSEIQS RENKCMAMYK KLSKWPECNA
260 270 280 290 300
LSRRLLLKNS DDWQFYLTYF DSVFRLIEEA WTPPAEGEHS LEGEVHCSAE
310 320 330 340 350
DAVKFIEDRI TEASQSSRHV RGPHLAKLEL IRRLRSQGCN DEYKLGDPEE
360 370 380 390 400
LMFQYFKKFG DKPCCFTDLK VFVDLLPAAQ CTQFINQLLG VVPLSTPTED
410 420 430 440 450
KLALPADIRG LQQHLCVVQL TRLLGLYHSM DKSQKLDVVK ELMLRYQHGL
460 470 480 490 500
EFGRSCLKTE LQFSDYYCLL AVHVLIDVWR EAGEETAVWQ ALTLLEEGLT
510 520 530 540 550
HSPSNAQFKL LLVRIYCVLG AFEPVVDLYS SLDAKHIQHD TIGYLLTRYA
560 570 580 590 600
ASLGQYAAAS QSCNFALRFF HSNQKDTSEY IIQAYKYGAF EKIPEFIAFR
610 620 630 640 650
NRLNNSLHFA QVRTERMLLD LLLEANISIS LAESIKSMNL RPEEDDVPWE
660 670 680 690 700
DLRDNRDLDV FFSWDPKDRN VSEEHKKLSL EEETMWLRIR SLTLRLISGL
710 720 730 740 750
PSLTHPVEPK NSEKMSENGV SSRIDILRLL LQQLEVAVET GKRFIEKEIQ
760 770 780 790 800
YPFLGPVPTR MGRFFSSGCC QCQVQSFHLV SDMYELDTSG LEGTVDIQER
810 820 830 840 850
IENSLASLLE LLKGVFSTCK GDLLEVTDGN VKTQPAVLEN LVFFVETISV
860 870 880 890 900
ILWVSSYCES VLRPYKLNIQ KKKKKKKETS IIMPPIFTSF QDYVTGLQTV
910 920 930 940 950
ISNAVDHIKG LEAHLIALRL EELTLEETSI STEERKFSKT VQGKVQSSYL
960 970
HSLLETGELL RKRLETTKKL KI
Length:972
Mass (Da):111,708
Last modified:March 1, 2003 - v1
Checksum:i1393A5B38DE26D54
GO
Isoform 2 (identifier: Q8BWZ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAK → MCRTLTTGASGPFT

Show »
Length:938
Mass (Da):107,519
Checksum:i41F599FEC3179712
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti424 – 4241L → I in BAE39569 (PubMed:16141072).Curated
Sequence conflicti424 – 4241L → I in BAE39494 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4848MATRG…LHCAK → MCRTLTTGASGPFT in isoform 2. 1 PublicationVSP_026631Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049325 mRNA. Translation: BAC33684.1.
AK149758 mRNA. Translation: BAE29066.1.
AK167405 mRNA. Translation: BAE39494.1.
AK167491 mRNA. Translation: BAE39569.1.
BC028868 mRNA. Translation: AAH28868.1.
BC055480 mRNA. Translation: AAH55480.1.
BC106182 mRNA. Translation: AAI06183.1.
BC132172 mRNA. Translation: AAI32173.1.
CCDSiCCDS19633.1. [Q8BWZ3-1]
RefSeqiNP_766310.2. NM_172722.3. [Q8BWZ3-1]
UniGeneiMm.33919.

Genome annotation databases

EnsembliENSMUST00000042163; ENSMUSP00000038977; ENSMUSG00000042719. [Q8BWZ3-1]
GeneIDi231713.
KEGGimmu:231713.
UCSCiuc008zjb.1. mouse. [Q8BWZ3-2]
uc008zjc.1. mouse. [Q8BWZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049325 mRNA. Translation: BAC33684.1.
AK149758 mRNA. Translation: BAE29066.1.
AK167405 mRNA. Translation: BAE39494.1.
AK167491 mRNA. Translation: BAE39569.1.
BC028868 mRNA. Translation: AAH28868.1.
BC055480 mRNA. Translation: AAH55480.1.
BC106182 mRNA. Translation: AAI06183.1.
BC132172 mRNA. Translation: AAI32173.1.
CCDSiCCDS19633.1. [Q8BWZ3-1]
RefSeqiNP_766310.2. NM_172722.3. [Q8BWZ3-1]
UniGeneiMm.33919.

3D structure databases

ProteinModelPortaliQ8BWZ3.
SMRiQ8BWZ3. Positions 30-147.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231159. 1 interaction.
IntActiQ8BWZ3. 1 interaction.
STRINGi10090.ENSMUSP00000038977.

PTM databases

iPTMnetiQ8BWZ3.
PhosphoSiteiQ8BWZ3.

Proteomic databases

EPDiQ8BWZ3.
MaxQBiQ8BWZ3.
PaxDbiQ8BWZ3.
PRIDEiQ8BWZ3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042163; ENSMUSP00000038977; ENSMUSG00000042719. [Q8BWZ3-1]
GeneIDi231713.
KEGGimmu:231713.
UCSCiuc008zjb.1. mouse. [Q8BWZ3-2]
uc008zjc.1. mouse. [Q8BWZ3-1]

Organism-specific databases

CTDi80018.
MGIiMGI:2442563. Naa25.

Phylogenomic databases

eggNOGiKOG2053. Eukaryota.
ENOG410XRXD. LUCA.
GeneTreeiENSGT00390000003496.
HOGENOMiHOG000060132.
InParanoidiQ8BWZ3.
KOiK17973.
OMAiMGPSDPY.
OrthoDBiEOG75F4CR.
PhylomeDBiQ8BWZ3.
TreeFamiTF315103.

Miscellaneous databases

NextBioi380719.
PROiQ8BWZ3.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BWZ3.
CleanExiMM_C330023M02RIK.
ExpressionAtlasiQ8BWZ3. baseline and differential.
GenevisibleiQ8BWZ3. MM.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR019183. N-acetylTrfase_B_cplx_non-cat.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF09797. NatB_MDM20. 1 hit.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.
PROSITEiPS50293. TPR_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Bone marrow, Embryonic stem cell and Placenta.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: FVB/N.
    Tissue: Brain, Embryo and Mammary tumor.
  3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiNAA25_MOUSE
AccessioniPrimary (citable) accession number: Q8BWZ3
Secondary accession number(s): A1A4B7
, Q3KQI7, Q3TJC6, Q7TMM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: May 11, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.