Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-alpha-acetyltransferase 25, NatB auxiliary subunit

Gene

Naa25

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Non-catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
N-alpha-acetyltransferase 25, NatB auxiliary subunit
Alternative name(s):
Mitochondrial distribution and morphology protein 20
N-terminal acetyltransferase B complex subunit MDM20
Short name:
NatB complex subunit MDM20
N-terminal acetyltransferase B complex subunit NAA25
Gene namesi
Name:Naa25
Synonyms:Mdm20
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi

Organism-specific databases

MGIiMGI:2442563 Naa25

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002943381 – 972N-alpha-acetyltransferase 25, NatB auxiliary subunitAdd BLAST972

Proteomic databases

EPDiQ8BWZ3
PaxDbiQ8BWZ3
PeptideAtlasiQ8BWZ3
PRIDEiQ8BWZ3

PTM databases

iPTMnetiQ8BWZ3
PhosphoSitePlusiQ8BWZ3
SwissPalmiQ8BWZ3

Expressioni

Gene expression databases

BgeeiENSMUSG00000042719
CleanExiMM_C330023M02RIK
ExpressionAtlasiQ8BWZ3 baseline and differential
GenevisibleiQ8BWZ3 MM

Interactioni

Subunit structurei

Component of the N-terminal acetyltransferase B (NatB) complex which is composed of NAA20 and NAA25.By similarity

Protein-protein interaction databases

BioGridi231159, 1 interactor
IntActiQ8BWZ3, 1 interactor
STRINGi10090.ENSMUSP00000038977

Structurei

3D structure databases

ProteinModelPortaliQ8BWZ3
SMRiQ8BWZ3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati11 – 44TPR 1Add BLAST34
Repeati45 – 78TPR 2Add BLAST34
Repeati79 – 112TPR 3Add BLAST34
Repeati114 – 146TPR 4Add BLAST33

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi871 – 877Poly-Lys7

Sequence similaritiesi

Belongs to the MDM20/NAA25 family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG2053 Eukaryota
ENOG410XRXD LUCA
GeneTreeiENSGT00390000003496
HOGENOMiHOG000060132
InParanoidiQ8BWZ3
KOiK17973
OMAiHTMDKNQ
OrthoDBiEOG091G029K
PhylomeDBiQ8BWZ3
TreeFamiTF315103

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR019183 N-acetylTrfase_B_cplx_non-cat
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR22767:SF3 PTHR22767:SF3, 1 hit
PfamiView protein in Pfam
PF09797 NatB_MDM20, 1 hit
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50293 TPR_REGION, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BWZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATRGHVQDP NDRRLRPIYD YLDNGNNKMA IQQADKLLKK HKDLHCAKVL
60 70 80 90 100
KAIGLQRTGK QEEAFTLAQE VAALEPTDDN SLQALTILYR EMHRPELVTK
110 120 130 140 150
LYEAAVKKVP NSEEYHSHLF MAYARVGEYK KMQQAGMALY KIVPKNPYYF
160 170 180 190 200
WSVMSLIMQS ISARDENLSK TMFLPLAERM VEKMVKEDKI EAEAEVELYY
210 220 230 240 250
MILERLGKYQ EALDVIRGKL GEKLTSEIQS RENKCMAMYK KLSKWPECNA
260 270 280 290 300
LSRRLLLKNS DDWQFYLTYF DSVFRLIEEA WTPPAEGEHS LEGEVHCSAE
310 320 330 340 350
DAVKFIEDRI TEASQSSRHV RGPHLAKLEL IRRLRSQGCN DEYKLGDPEE
360 370 380 390 400
LMFQYFKKFG DKPCCFTDLK VFVDLLPAAQ CTQFINQLLG VVPLSTPTED
410 420 430 440 450
KLALPADIRG LQQHLCVVQL TRLLGLYHSM DKSQKLDVVK ELMLRYQHGL
460 470 480 490 500
EFGRSCLKTE LQFSDYYCLL AVHVLIDVWR EAGEETAVWQ ALTLLEEGLT
510 520 530 540 550
HSPSNAQFKL LLVRIYCVLG AFEPVVDLYS SLDAKHIQHD TIGYLLTRYA
560 570 580 590 600
ASLGQYAAAS QSCNFALRFF HSNQKDTSEY IIQAYKYGAF EKIPEFIAFR
610 620 630 640 650
NRLNNSLHFA QVRTERMLLD LLLEANISIS LAESIKSMNL RPEEDDVPWE
660 670 680 690 700
DLRDNRDLDV FFSWDPKDRN VSEEHKKLSL EEETMWLRIR SLTLRLISGL
710 720 730 740 750
PSLTHPVEPK NSEKMSENGV SSRIDILRLL LQQLEVAVET GKRFIEKEIQ
760 770 780 790 800
YPFLGPVPTR MGRFFSSGCC QCQVQSFHLV SDMYELDTSG LEGTVDIQER
810 820 830 840 850
IENSLASLLE LLKGVFSTCK GDLLEVTDGN VKTQPAVLEN LVFFVETISV
860 870 880 890 900
ILWVSSYCES VLRPYKLNIQ KKKKKKKETS IIMPPIFTSF QDYVTGLQTV
910 920 930 940 950
ISNAVDHIKG LEAHLIALRL EELTLEETSI STEERKFSKT VQGKVQSSYL
960 970
HSLLETGELL RKRLETTKKL KI
Length:972
Mass (Da):111,708
Last modified:March 1, 2003 - v1
Checksum:i1393A5B38DE26D54
GO
Isoform 2 (identifier: Q8BWZ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAK → MCRTLTTGASGPFT

Show »
Length:938
Mass (Da):107,519
Checksum:i41F599FEC3179712
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti424L → I in BAE39569 (PubMed:16141072).Curated1
Sequence conflicti424L → I in BAE39494 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0266311 – 48MATRG…LHCAK → MCRTLTTGASGPFT in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049325 mRNA Translation: BAC33684.1
AK149758 mRNA Translation: BAE29066.1
AK167405 mRNA Translation: BAE39494.1
AK167491 mRNA Translation: BAE39569.1
BC028868 mRNA Translation: AAH28868.1
BC055480 mRNA Translation: AAH55480.1
BC106182 mRNA Translation: AAI06183.1
BC132172 mRNA Translation: AAI32173.1
CCDSiCCDS19633.1 [Q8BWZ3-1]
RefSeqiNP_766310.2, NM_172722.3 [Q8BWZ3-1]
UniGeneiMm.33919

Genome annotation databases

EnsembliENSMUST00000042163; ENSMUSP00000038977; ENSMUSG00000042719 [Q8BWZ3-1]
GeneIDi231713
KEGGimmu:231713
UCSCiuc008zjb.1 mouse [Q8BWZ3-2]
uc008zjc.1 mouse [Q8BWZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Entry informationi

Entry nameiNAA25_MOUSE
AccessioniPrimary (citable) accession number: Q8BWZ3
Secondary accession number(s): A1A4B7
, Q3KQI7, Q3TJC6, Q7TMM2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: May 23, 2018
This is version 119 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health