Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8BWY7

- S39AB_MOUSE

UniProt

Q8BWY7 - S39AB_MOUSE

Protein

Zinc transporter ZIP11

Gene

Slc39a11

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 76 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as a zinc-influx transporter.By similarity

    GO - Molecular functioni

    1. metal ion transmembrane transporter activity Source: InterPro

    GO - Biological processi

    1. zinc ion transport Source: UniProtKB-KW

    Keywords - Biological processi

    Ion transport, Transport, Zinc transport

    Keywords - Ligandi

    Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc transporter ZIP11
    Alternative name(s):
    Solute carrier family 39 member 11
    Zrt- and Irt-like protein 11
    Short name:
    ZIP-11
    Gene namesi
    Name:Slc39a11
    Synonyms:Zip11
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1917056. Slc39a11.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 342342Zinc transporter ZIP11PRO_0000308411Add
    BLAST

    Proteomic databases

    PaxDbiQ8BWY7.
    PRIDEiQ8BWY7.

    PTM databases

    PhosphoSiteiQ8BWY7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8BWY7.
    BgeeiQ8BWY7.
    GenevestigatoriQ8BWY7.

    Interactioni

    Protein-protein interaction databases

    IntActiQ8BWY7. 1 interaction.
    MINTiMINT-219051.

    Structurei

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei12 – 3221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei44 – 6421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei72 – 9221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei194 – 21421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei263 – 28523HelicalSequence AnalysisAdd
    BLAST
    Transmembranei290 – 30718HelicalSequence AnalysisAdd
    BLAST
    Transmembranei322 – 34221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0428.
    GeneTreeiENSGT00390000006167.
    HOGENOMiHOG000232703.
    HOVERGENiHBG108448.
    KOiK14717.
    OMAiGEFAFIP.
    OrthoDBiEOG7S21Z9.
    PhylomeDBiQ8BWY7.
    TreeFamiTF105905.

    Family and domain databases

    InterProiIPR003689. ZIP.
    [Graphical view]
    PfamiPF02535. Zip. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8BWY7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLQGYSSVVQ ALLGTFFTWA MTAAGAALVF IFSSGQRRIL DGSLGFAAGV    50
    MLAASYWSLL APAVEMATSS GGFGAFAFFP VAVGFTLGAA FVYLADLLMP 100
    HLGATEDPQT ALALNLDPAL MKKSDPRDPT SLLFPESELS IRIGSTGLLS 150
    DKRENGEVYQ RKKVAATDLA EGVAPSGSMH GSSGQPGGSS WRRIALLILA 200
    ITIHNIPEGL AVGVGFGAVE KTASATFESA RNLAIGIGIQ NFPEGLAVSL 250
    PLRGAGFSTW KAFWYGQLSG MVEPLAGVFG AFAVVLAEPI LPYALAFAAG 300
    AMVYVVMDDI IPEAQISGNG KLASWASILG FVVMMSLDVG LG 342
    Length:342
    Mass (Da):35,466
    Last modified:March 1, 2003 - v1
    Checksum:i3A5F4517D0D5652D
    GO
    Isoform 2 (identifier: Q8BWY7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         102-102: L → LLQVSFLPSGDCKMPTATKTPLLGRTRAVELLGGNQ
         144-150: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:370
    Mass (Da):38,533
    Checksum:i090460A70783A6F8
    GO
    Isoform 3 (identifier: Q8BWY7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         144-150: Missing.

    Show »
    Length:335
    Mass (Da):34,850
    Checksum:i776409F723481B9E
    GO

    Sequence cautioni

    The sequence AAH04643.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.
    The sequence AAH04643.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti22 – 221T → S in AAH19647. (PubMed:15489334)Curated
    Sequence conflicti49 – 491G → V in BAC29664. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei102 – 1021L → LLQVSFLPSGDCKMPTATKT PLLGRTRAVELLGGNQ in isoform 2. 1 PublicationVSP_028977
    Alternative sequencei144 – 1507Missing in isoform 2 and isoform 3. 2 PublicationsVSP_028978

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK007986 mRNA. Translation: BAB25390.1.
    AK036999 mRNA. Translation: BAC29664.1.
    AK049368 mRNA. Translation: BAC33713.1.
    AK170673 mRNA. Translation: BAE41950.1.
    AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20947.1.
    AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20948.1.
    AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20949.1.
    AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23990.1.
    AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23991.1.
    AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23992.1.
    AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24793.1.
    AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24794.1.
    AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24795.1.
    BC004643 mRNA. Translation: AAH04643.1. Different initiation.
    BC019647 mRNA. Translation: AAH19647.1.
    BC031751 mRNA. Translation: AAH31751.1.
    CCDSiCCDS36363.1. [Q8BWY7-3]
    CCDS48975.1. [Q8BWY7-1]
    RefSeqiNP_001159975.1. NM_001166503.1. [Q8BWY7-1]
    NP_081492.4. NM_027216.5. [Q8BWY7-3]
    XP_006534190.1. XM_006534127.1. [Q8BWY7-1]
    XP_006534191.1. XM_006534128.1. [Q8BWY7-1]
    XP_006534192.1. XM_006534129.1. [Q8BWY7-1]
    XP_006534193.1. XM_006534130.1. [Q8BWY7-1]
    XP_006534194.1. XM_006534131.1. [Q8BWY7-1]
    XP_006534195.1. XM_006534132.1. [Q8BWY7-1]
    XP_006534196.1. XM_006534133.1. [Q8BWY7-1]
    XP_006534197.1. XM_006534134.1. [Q8BWY7-3]
    UniGeneiMm.341021.

    Genome annotation databases

    EnsembliENSMUST00000042657; ENSMUSP00000037331; ENSMUSG00000041654. [Q8BWY7-2]
    ENSMUST00000071539; ENSMUSP00000071469; ENSMUSG00000041654. [Q8BWY7-3]
    ENSMUST00000106633; ENSMUSP00000102244; ENSMUSG00000041654. [Q8BWY7-1]
    GeneIDi69806.
    KEGGimmu:69806.
    UCSCiuc007mem.2. mouse. [Q8BWY7-3]
    uc007men.2. mouse. [Q8BWY7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK007986 mRNA. Translation: BAB25390.1 .
    AK036999 mRNA. Translation: BAC29664.1 .
    AK049368 mRNA. Translation: BAC33713.1 .
    AK170673 mRNA. Translation: BAE41950.1 .
    AL596104 , AL603705 , AL604025 Genomic DNA. Translation: CAM20947.1 .
    AL596104 , AL603705 , AL604025 Genomic DNA. Translation: CAM20948.1 .
    AL596104 , AL603705 , AL604025 Genomic DNA. Translation: CAM20949.1 .
    AL603705 , AL596104 , AL604025 Genomic DNA. Translation: CAM23990.1 .
    AL603705 , AL596104 , AL604025 Genomic DNA. Translation: CAM23991.1 .
    AL603705 , AL596104 , AL604025 Genomic DNA. Translation: CAM23992.1 .
    AL604025 , AL596104 , AL603705 Genomic DNA. Translation: CAM24793.1 .
    AL604025 , AL596104 , AL603705 Genomic DNA. Translation: CAM24794.1 .
    AL604025 , AL596104 , AL603705 Genomic DNA. Translation: CAM24795.1 .
    BC004643 mRNA. Translation: AAH04643.1 . Different initiation.
    BC019647 mRNA. Translation: AAH19647.1 .
    BC031751 mRNA. Translation: AAH31751.1 .
    CCDSi CCDS36363.1. [Q8BWY7-3 ]
    CCDS48975.1. [Q8BWY7-1 ]
    RefSeqi NP_001159975.1. NM_001166503.1. [Q8BWY7-1 ]
    NP_081492.4. NM_027216.5. [Q8BWY7-3 ]
    XP_006534190.1. XM_006534127.1. [Q8BWY7-1 ]
    XP_006534191.1. XM_006534128.1. [Q8BWY7-1 ]
    XP_006534192.1. XM_006534129.1. [Q8BWY7-1 ]
    XP_006534193.1. XM_006534130.1. [Q8BWY7-1 ]
    XP_006534194.1. XM_006534131.1. [Q8BWY7-1 ]
    XP_006534195.1. XM_006534132.1. [Q8BWY7-1 ]
    XP_006534196.1. XM_006534133.1. [Q8BWY7-1 ]
    XP_006534197.1. XM_006534134.1. [Q8BWY7-3 ]
    UniGenei Mm.341021.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q8BWY7. 1 interaction.
    MINTi MINT-219051.

    PTM databases

    PhosphoSitei Q8BWY7.

    Proteomic databases

    PaxDbi Q8BWY7.
    PRIDEi Q8BWY7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000042657 ; ENSMUSP00000037331 ; ENSMUSG00000041654 . [Q8BWY7-2 ]
    ENSMUST00000071539 ; ENSMUSP00000071469 ; ENSMUSG00000041654 . [Q8BWY7-3 ]
    ENSMUST00000106633 ; ENSMUSP00000102244 ; ENSMUSG00000041654 . [Q8BWY7-1 ]
    GeneIDi 69806.
    KEGGi mmu:69806.
    UCSCi uc007mem.2. mouse. [Q8BWY7-3 ]
    uc007men.2. mouse. [Q8BWY7-1 ]

    Organism-specific databases

    CTDi 201266.
    MGIi MGI:1917056. Slc39a11.

    Phylogenomic databases

    eggNOGi COG0428.
    GeneTreei ENSGT00390000006167.
    HOGENOMi HOG000232703.
    HOVERGENi HBG108448.
    KOi K14717.
    OMAi GEFAFIP.
    OrthoDBi EOG7S21Z9.
    PhylomeDBi Q8BWY7.
    TreeFami TF105905.

    Miscellaneous databases

    ChiTaRSi SLC39A11. mouse.
    NextBioi 330378.
    PROi Q8BWY7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8BWY7.
    Bgeei Q8BWY7.
    Genevestigatori Q8BWY7.

    Family and domain databases

    InterProi IPR003689. ZIP.
    [Graphical view ]
    Pfami PF02535. Zip. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Strain: C57BL/6J and NOD.
      Tissue: Pancreas and Vagina.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Strain: FVB/N.
      Tissue: Colon and Mammary tumor.

    Entry informationi

    Entry nameiS39AB_MOUSE
    AccessioniPrimary (citable) accession number: Q8BWY7
    Secondary accession number(s): Q8BZ08
    , Q8K0E0, Q8VE72, Q99KI2, Q9D8J0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 76 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3