Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8BWY7 (S39AB_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 75. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc transporter ZIP11
Alternative name(s):
Solute carrier family 39 member 11
Zrt- and Irt-like protein 11
Short name=ZIP-11
Gene names
Name:Slc39a11
Synonyms:Zip11
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length342 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May act as a zinc-influx transporter By similarity.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the ZIP transporter (TC 2.A.5) family. [View classification]

Sequence caution

The sequence AAH04643.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH04643.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.

Ontologies

Keywords
   Biological processIon transport
Transport
Zinc transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandZinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processzinc ion transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionmetal ion transmembrane transporter activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8BWY7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8BWY7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     102-102: L → LLQVSFLPSGDCKMPTATKTPLLGRTRAVELLGGNQ
     144-150: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8BWY7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     144-150: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 342342Zinc transporter ZIP11
PRO_0000308411

Regions

Transmembrane12 – 3221Helical; Potential
Transmembrane44 – 6421Helical; Potential
Transmembrane72 – 9221Helical; Potential
Transmembrane194 – 21421Helical; Potential
Transmembrane263 – 28523Helical; Potential
Transmembrane290 – 30718Helical; Potential
Transmembrane322 – 34221Helical; Potential

Natural variations

Alternative sequence1021L → LLQVSFLPSGDCKMPTATKT PLLGRTRAVELLGGNQ in isoform 2.
VSP_028977
Alternative sequence144 – 1507Missing in isoform 2 and isoform 3.
VSP_028978

Experimental info

Sequence conflict221T → S in AAH19647. Ref.3
Sequence conflict491G → V in BAC29664. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: 3A5F4517D0D5652D

FASTA34235,466
        10         20         30         40         50         60 
MLQGYSSVVQ ALLGTFFTWA MTAAGAALVF IFSSGQRRIL DGSLGFAAGV MLAASYWSLL 

        70         80         90        100        110        120 
APAVEMATSS GGFGAFAFFP VAVGFTLGAA FVYLADLLMP HLGATEDPQT ALALNLDPAL 

       130        140        150        160        170        180 
MKKSDPRDPT SLLFPESELS IRIGSTGLLS DKRENGEVYQ RKKVAATDLA EGVAPSGSMH 

       190        200        210        220        230        240 
GSSGQPGGSS WRRIALLILA ITIHNIPEGL AVGVGFGAVE KTASATFESA RNLAIGIGIQ 

       250        260        270        280        290        300 
NFPEGLAVSL PLRGAGFSTW KAFWYGQLSG MVEPLAGVFG AFAVVLAEPI LPYALAFAAG 

       310        320        330        340 
AMVYVVMDDI IPEAQISGNG KLASWASILG FVVMMSLDVG LG 

« Hide

Isoform 2 [UniParc].

Checksum: 090460A70783A6F8
Show »

FASTA37038,533
Isoform 3 [UniParc].

Checksum: 776409F723481B9E
Show »

FASTA33534,850

References

[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Strain: C57BL/6J and NOD.
Tissue: Pancreas and Vagina.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: FVB/N.
Tissue: Colon and Mammary tumor.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK007986 mRNA. Translation: BAB25390.1.
AK036999 mRNA. Translation: BAC29664.1.
AK049368 mRNA. Translation: BAC33713.1.
AK170673 mRNA. Translation: BAE41950.1.
AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20947.1.
AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20948.1.
AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20949.1.
AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23990.1.
AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23991.1.
AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23992.1.
AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24793.1.
AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24794.1.
AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24795.1.
BC004643 mRNA. Translation: AAH04643.1. Different initiation.
BC019647 mRNA. Translation: AAH19647.1.
BC031751 mRNA. Translation: AAH31751.1.
CCDSCCDS36363.1. [Q8BWY7-3]
CCDS48975.1. [Q8BWY7-1]
RefSeqNP_001159975.1. NM_001166503.1. [Q8BWY7-1]
NP_081492.4. NM_027216.5. [Q8BWY7-3]
XP_006534190.1. XM_006534127.1. [Q8BWY7-1]
XP_006534191.1. XM_006534128.1. [Q8BWY7-1]
XP_006534192.1. XM_006534129.1. [Q8BWY7-1]
XP_006534193.1. XM_006534130.1. [Q8BWY7-1]
XP_006534194.1. XM_006534131.1. [Q8BWY7-1]
XP_006534195.1. XM_006534132.1. [Q8BWY7-1]
XP_006534196.1. XM_006534133.1. [Q8BWY7-1]
XP_006534197.1. XM_006534134.1. [Q8BWY7-3]
UniGeneMm.341021.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ8BWY7. 1 interaction.
MINTMINT-219051.

PTM databases

PhosphoSiteQ8BWY7.

Proteomic databases

PaxDbQ8BWY7.
PRIDEQ8BWY7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000042657; ENSMUSP00000037331; ENSMUSG00000041654. [Q8BWY7-2]
ENSMUST00000071539; ENSMUSP00000071469; ENSMUSG00000041654. [Q8BWY7-3]
ENSMUST00000106633; ENSMUSP00000102244; ENSMUSG00000041654. [Q8BWY7-1]
GeneID69806.
KEGGmmu:69806.
UCSCuc007mem.2. mouse. [Q8BWY7-3]
uc007men.2. mouse. [Q8BWY7-1]

Organism-specific databases

CTD201266.
MGIMGI:1917056. Slc39a11.

Phylogenomic databases

eggNOGCOG0428.
GeneTreeENSGT00390000006167.
HOGENOMHOG000232703.
HOVERGENHBG108448.
KOK14717.
OMAGEFAFIP.
OrthoDBEOG7S21Z9.
PhylomeDBQ8BWY7.
TreeFamTF105905.

Gene expression databases

ArrayExpressQ8BWY7.
BgeeQ8BWY7.
GenevestigatorQ8BWY7.

Family and domain databases

InterProIPR003689. ZIP.
[Graphical view]
PfamPF02535. Zip. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLC39A11. mouse.
NextBio330378.
PROQ8BWY7.
SOURCESearch...

Entry information

Entry nameS39AB_MOUSE
AccessionPrimary (citable) accession number: Q8BWY7
Secondary accession number(s): Q8BZ08 expand/collapse secondary AC list , Q8K0E0, Q8VE72, Q99KI2, Q9D8J0
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot