Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8BWY7

- S39AB_MOUSE

UniProt

Q8BWY7 - S39AB_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc transporter ZIP11

Gene

Slc39a11

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

May act as a zinc-influx transporter.By similarity

GO - Molecular functioni

  1. metal ion transmembrane transporter activity Source: InterPro

GO - Biological processi

  1. zinc ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport, Zinc transport

Keywords - Ligandi

Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter ZIP11
Alternative name(s):
Solute carrier family 39 member 11
Zrt- and Irt-like protein 11
Short name:
ZIP-11
Gene namesi
Name:Slc39a11
Synonyms:Zip11
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:1917056. Slc39a11.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei12 – 3221HelicalSequence AnalysisAdd
BLAST
Transmembranei44 – 6421HelicalSequence AnalysisAdd
BLAST
Transmembranei72 – 9221HelicalSequence AnalysisAdd
BLAST
Transmembranei194 – 21421HelicalSequence AnalysisAdd
BLAST
Transmembranei263 – 28523HelicalSequence AnalysisAdd
BLAST
Transmembranei290 – 30718HelicalSequence AnalysisAdd
BLAST
Transmembranei322 – 34221HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 342342Zinc transporter ZIP11PRO_0000308411Add
BLAST

Proteomic databases

MaxQBiQ8BWY7.
PaxDbiQ8BWY7.
PRIDEiQ8BWY7.

PTM databases

PhosphoSiteiQ8BWY7.

Expressioni

Gene expression databases

BgeeiQ8BWY7.
ExpressionAtlasiQ8BWY7. baseline and differential.
GenevestigatoriQ8BWY7.

Interactioni

Protein-protein interaction databases

IntActiQ8BWY7. 1 interaction.
MINTiMINT-219051.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0428.
GeneTreeiENSGT00390000006167.
HOGENOMiHOG000232703.
HOVERGENiHBG108448.
InParanoidiQ8BWY7.
KOiK14717.
OMAiGEFAFIP.
OrthoDBiEOG7S21Z9.
PhylomeDBiQ8BWY7.
TreeFamiTF105905.

Family and domain databases

InterProiIPR003689. ZIP.
[Graphical view]
PfamiPF02535. Zip. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8BWY7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLQGYSSVVQ ALLGTFFTWA MTAAGAALVF IFSSGQRRIL DGSLGFAAGV
60 70 80 90 100
MLAASYWSLL APAVEMATSS GGFGAFAFFP VAVGFTLGAA FVYLADLLMP
110 120 130 140 150
HLGATEDPQT ALALNLDPAL MKKSDPRDPT SLLFPESELS IRIGSTGLLS
160 170 180 190 200
DKRENGEVYQ RKKVAATDLA EGVAPSGSMH GSSGQPGGSS WRRIALLILA
210 220 230 240 250
ITIHNIPEGL AVGVGFGAVE KTASATFESA RNLAIGIGIQ NFPEGLAVSL
260 270 280 290 300
PLRGAGFSTW KAFWYGQLSG MVEPLAGVFG AFAVVLAEPI LPYALAFAAG
310 320 330 340
AMVYVVMDDI IPEAQISGNG KLASWASILG FVVMMSLDVG LG
Length:342
Mass (Da):35,466
Last modified:March 1, 2003 - v1
Checksum:i3A5F4517D0D5652D
GO
Isoform 2 (identifier: Q8BWY7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-102: L → LLQVSFLPSGDCKMPTATKTPLLGRTRAVELLGGNQ
     144-150: Missing.

Note: No experimental confirmation available.

Show »
Length:370
Mass (Da):38,533
Checksum:i090460A70783A6F8
GO
Isoform 3 (identifier: Q8BWY7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-150: Missing.

Show »
Length:335
Mass (Da):34,850
Checksum:i776409F723481B9E
GO

Sequence cautioni

The sequence AAH04643.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence AAH04643.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti22 – 221T → S in AAH19647. (PubMed:15489334)Curated
Sequence conflicti49 – 491G → V in BAC29664. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei102 – 1021L → LLQVSFLPSGDCKMPTATKT PLLGRTRAVELLGGNQ in isoform 2. 1 PublicationVSP_028977
Alternative sequencei144 – 1507Missing in isoform 2 and isoform 3. 2 PublicationsVSP_028978

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007986 mRNA. Translation: BAB25390.1.
AK036999 mRNA. Translation: BAC29664.1.
AK049368 mRNA. Translation: BAC33713.1.
AK170673 mRNA. Translation: BAE41950.1.
AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20947.1.
AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20948.1.
AL596104, AL603705, AL604025 Genomic DNA. Translation: CAM20949.1.
AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23990.1.
AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23991.1.
AL603705, AL596104, AL604025 Genomic DNA. Translation: CAM23992.1.
AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24793.1.
AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24794.1.
AL604025, AL596104, AL603705 Genomic DNA. Translation: CAM24795.1.
BC004643 mRNA. Translation: AAH04643.1. Different initiation.
BC019647 mRNA. Translation: AAH19647.1.
BC031751 mRNA. Translation: AAH31751.1.
CCDSiCCDS36363.1. [Q8BWY7-3]
CCDS48975.1. [Q8BWY7-1]
RefSeqiNP_001159975.1. NM_001166503.1. [Q8BWY7-1]
NP_081492.4. NM_027216.5. [Q8BWY7-3]
XP_006534190.1. XM_006534127.1. [Q8BWY7-1]
XP_006534191.1. XM_006534128.1. [Q8BWY7-1]
XP_006534192.1. XM_006534129.1. [Q8BWY7-1]
XP_006534193.1. XM_006534130.1. [Q8BWY7-1]
XP_006534194.1. XM_006534131.1. [Q8BWY7-1]
XP_006534195.1. XM_006534132.1. [Q8BWY7-1]
XP_006534196.1. XM_006534133.1. [Q8BWY7-1]
XP_006534197.1. XM_006534134.1. [Q8BWY7-3]
UniGeneiMm.341021.

Genome annotation databases

EnsembliENSMUST00000042657; ENSMUSP00000037331; ENSMUSG00000041654. [Q8BWY7-2]
ENSMUST00000071539; ENSMUSP00000071469; ENSMUSG00000041654. [Q8BWY7-3]
ENSMUST00000106633; ENSMUSP00000102244; ENSMUSG00000041654. [Q8BWY7-1]
GeneIDi69806.
KEGGimmu:69806.
UCSCiuc007mem.2. mouse. [Q8BWY7-3]
uc007men.2. mouse. [Q8BWY7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007986 mRNA. Translation: BAB25390.1 .
AK036999 mRNA. Translation: BAC29664.1 .
AK049368 mRNA. Translation: BAC33713.1 .
AK170673 mRNA. Translation: BAE41950.1 .
AL596104 , AL603705 , AL604025 Genomic DNA. Translation: CAM20947.1 .
AL596104 , AL603705 , AL604025 Genomic DNA. Translation: CAM20948.1 .
AL596104 , AL603705 , AL604025 Genomic DNA. Translation: CAM20949.1 .
AL603705 , AL596104 , AL604025 Genomic DNA. Translation: CAM23990.1 .
AL603705 , AL596104 , AL604025 Genomic DNA. Translation: CAM23991.1 .
AL603705 , AL596104 , AL604025 Genomic DNA. Translation: CAM23992.1 .
AL604025 , AL596104 , AL603705 Genomic DNA. Translation: CAM24793.1 .
AL604025 , AL596104 , AL603705 Genomic DNA. Translation: CAM24794.1 .
AL604025 , AL596104 , AL603705 Genomic DNA. Translation: CAM24795.1 .
BC004643 mRNA. Translation: AAH04643.1 . Different initiation.
BC019647 mRNA. Translation: AAH19647.1 .
BC031751 mRNA. Translation: AAH31751.1 .
CCDSi CCDS36363.1. [Q8BWY7-3 ]
CCDS48975.1. [Q8BWY7-1 ]
RefSeqi NP_001159975.1. NM_001166503.1. [Q8BWY7-1 ]
NP_081492.4. NM_027216.5. [Q8BWY7-3 ]
XP_006534190.1. XM_006534127.1. [Q8BWY7-1 ]
XP_006534191.1. XM_006534128.1. [Q8BWY7-1 ]
XP_006534192.1. XM_006534129.1. [Q8BWY7-1 ]
XP_006534193.1. XM_006534130.1. [Q8BWY7-1 ]
XP_006534194.1. XM_006534131.1. [Q8BWY7-1 ]
XP_006534195.1. XM_006534132.1. [Q8BWY7-1 ]
XP_006534196.1. XM_006534133.1. [Q8BWY7-1 ]
XP_006534197.1. XM_006534134.1. [Q8BWY7-3 ]
UniGenei Mm.341021.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q8BWY7. 1 interaction.
MINTi MINT-219051.

PTM databases

PhosphoSitei Q8BWY7.

Proteomic databases

MaxQBi Q8BWY7.
PaxDbi Q8BWY7.
PRIDEi Q8BWY7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000042657 ; ENSMUSP00000037331 ; ENSMUSG00000041654 . [Q8BWY7-2 ]
ENSMUST00000071539 ; ENSMUSP00000071469 ; ENSMUSG00000041654 . [Q8BWY7-3 ]
ENSMUST00000106633 ; ENSMUSP00000102244 ; ENSMUSG00000041654 . [Q8BWY7-1 ]
GeneIDi 69806.
KEGGi mmu:69806.
UCSCi uc007mem.2. mouse. [Q8BWY7-3 ]
uc007men.2. mouse. [Q8BWY7-1 ]

Organism-specific databases

CTDi 201266.
MGIi MGI:1917056. Slc39a11.

Phylogenomic databases

eggNOGi COG0428.
GeneTreei ENSGT00390000006167.
HOGENOMi HOG000232703.
HOVERGENi HBG108448.
InParanoidi Q8BWY7.
KOi K14717.
OMAi GEFAFIP.
OrthoDBi EOG7S21Z9.
PhylomeDBi Q8BWY7.
TreeFami TF105905.

Miscellaneous databases

ChiTaRSi Slc39a11. mouse.
NextBioi 330378.
PROi Q8BWY7.
SOURCEi Search...

Gene expression databases

Bgeei Q8BWY7.
ExpressionAtlasi Q8BWY7. baseline and differential.
Genevestigatori Q8BWY7.

Family and domain databases

InterProi IPR003689. ZIP.
[Graphical view ]
Pfami PF02535. Zip. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Pancreas and Vagina.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: FVB/N.
    Tissue: Colon and Mammary tumor.

Entry informationi

Entry nameiS39AB_MOUSE
AccessioniPrimary (citable) accession number: Q8BWY7
Secondary accession number(s): Q8BZ08
, Q8K0E0, Q8VE72, Q99KI2, Q9D8J0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 1, 2003
Last modified: November 26, 2014
This is version 78 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3