Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding motif, single-stranded-interacting protein 3

Gene

Rbms3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Binds poly(A) and poly(U) oligoribonucleotides.By similarity

GO - Molecular functioni

  • mRNA 3'-UTR binding Source: MGI
  • nucleotide binding Source: InterPro

GO - Biological processi

  • positive regulation of translation Source: MGI
Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding motif, single-stranded-interacting protein 3
Gene namesi
Name:Rbms3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2444477. Rbms3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 431431RNA-binding motif, single-stranded-interacting protein 3PRO_0000274907Add
BLAST

Proteomic databases

EPDiQ8BWL5.
MaxQBiQ8BWL5.
PaxDbiQ8BWL5.
PRIDEiQ8BWL5.

PTM databases

iPTMnetiQ8BWL5.
PhosphoSiteiQ8BWL5.

Expressioni

Gene expression databases

BgeeiQ8BWL5.
ExpressionAtlasiQ8BWL5. baseline and differential.
GenevisibleiQ8BWL5. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131371.

Structurei

3D structure databases

ProteinModelPortaliQ8BWL5.
SMRiQ8BWL5. Positions 45-218.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini56 – 12974RRM 1PROSITE-ProRule annotationAdd
BLAST
Domaini135 – 22086RRM 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG4733. Eukaryota.
ENOG410XRB5. LUCA.
GeneTreeiENSGT00760000118913.
HOVERGENiHBG053108.
InParanoidiQ8BWL5.
OMAiPMYPQYT.
OrthoDBiEOG71G9V3.
PhylomeDBiQ8BWL5.
TreeFamiTF314644.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR002343. Hud_Sxl_RNA.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 2 hits.
[Graphical view]
PRINTSiPR00961. HUDSXLRNA.
SMARTiSM00360. RRM. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BWL5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKRLDQPQM YPQYTYYCPQ YLQTKQSYAP APHPMAPPSP STNSSSNSSG
60 70 80 90 100
EQLSKTNLYI RGLPPGTTDQ DLIKLCQPYG KIVSTKAILD KNTNQCKGYG
110 120 130 140 150
FVDFDSPAAA QKAVASLKAN GVQAQMAKQQ EQDPTNLYIS NLPISMDEQE
160 170 180 190 200
LENMLKPFGH VISTRILRDA NGVSRGVGFA RMESTEKCEV VIQHFNGKYL
210 220 230 240 250
KTPPGIPAPS EPLLCKFADG GQKKRQGQSK HTQNGRPWPR EGEAGMALTY
260 270 280 290 300
DPTAALQNGF YSSPYSLATN RMIPQTSITP FIAASPVSTY QVQSTSWTPH
310 320 330 340 350
LPYIMQPTGA VITPAVDHPM SMQPTNIVGP LTQQMNHLSL GTAGTIQSQD
360 370 380 390 400
RIMVLHQLLC QYMTAAPMQG TYIPQYTPVP PTAVSIEGVV ADTSPQTVAP
410 420 430
SSQDSSGQQQ QLAVDTPSEH APAYSFQQSK P
Length:431
Mass (Da):46,927
Last modified:February 6, 2007 - v2
Checksum:i65D096613FDF783A
GO
Isoform 2 (identifier: Q8BWL5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-361: Missing.

Show »
Length:415
Mass (Da):45,020
Checksum:i58C0229A95698D24
GO
Isoform 3 (identifier: Q8BWL5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     292-308: Missing.

Show »
Length:414
Mass (Da):44,959
Checksum:i5EC4B16CBE0A3A1A
GO
Isoform 4 (identifier: Q8BWL5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-361: Missing.
     388-431: GVVADTSPQTVAPSSQDSSGQQQQLAVDTPSEHAPAYSFQQSKP → TIDRSEDVCLNLYLQ

Show »
Length:386
Mass (Da):42,244
Checksum:iFFF527486383B871
GO
Isoform 5 (identifier: Q8BWL5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGKRLDQPQMYPQYTYYCPQYLQTKQ → MEGGRLLIRS...SYTYCTGHPV
     292-308: Missing.

Show »
Length:463
Mass (Da):50,004
Checksum:i7AD6BA9A8BA0D5AF
GO
Isoform 6 (identifier: Q8BWL5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-431: GVVADTSPQTVAPSSQDSSGQQQQLAVDTPSEHAPAYSFQQSKP → TIDRSEDVCLNLYLQ

Show »
Length:402
Mass (Da):44,151
Checksum:i2817B4A05DBF50A4
GO

Sequence cautioni

The sequence BAC34878.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti10 – 101M → I in BAC26980 (PubMed:16141072).Curated
Sequence conflicti20 – 201Q → H in BAC26980 (PubMed:16141072).Curated
Sequence conflicti309 – 3091G → S in AAI08403 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2626MGKRL…LQTKQ → MEGGRLLIRSNANGVTQSNS TVRAYQSSKSRVTMSPGFSS QWSNSQPAWNTYSFPRASLH YQSHASYTYCTGHPV in isoform 5. 1 PublicationVSP_022932Add
BLAST
Alternative sequencei292 – 30817Missing in isoform 3 and isoform 5. 2 PublicationsVSP_022933Add
BLAST
Alternative sequencei346 – 36116Missing in isoform 2 and isoform 4. 1 PublicationVSP_022934Add
BLAST
Alternative sequencei388 – 43144GVVAD…QQSKP → TIDRSEDVCLNLYLQ in isoform 4 and isoform 6. 1 PublicationVSP_022935Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK030478 mRNA. Translation: BAC26980.1.
AK030609 mRNA. Translation: BAC27045.1.
AK032938 mRNA. Translation: BAC28091.1.
AK033005 mRNA. Translation: BAC28122.1.
AK041098 mRNA. Translation: BAC30820.1.
AK046197 mRNA. Translation: BAC32633.1.
AK052196 mRNA. Translation: BAC34878.1. Different initiation.
BC108402 mRNA. Translation: AAI08403.1.
BC117841 mRNA. Translation: AAI17842.1.
CCDSiCCDS40798.1. [Q8BWL5-3]
CCDS52955.1. [Q8BWL5-2]
CCDS52956.1. [Q8BWL5-6]
CCDS52957.1. [Q8BWL5-1]
CCDS57711.1. [Q8BWL5-4]
CCDS57712.1. [Q8BWL5-5]
RefSeqiNP_001165592.1. NM_001172121.1. [Q8BWL5-5]
NP_001165593.1. NM_001172122.1. [Q8BWL5-2]
NP_001165594.1. NM_001172123.1. [Q8BWL5-1]
NP_001165595.1. NM_001172124.1. [Q8BWL5-6]
NP_001165597.1. NM_001172126.1. [Q8BWL5-4]
NP_848775.2. NM_178660.4. [Q8BWL5-3]
UniGeneiMm.326411.

Genome annotation databases

EnsembliENSMUST00000044901; ENSMUSP00000039706; ENSMUSG00000039607. [Q8BWL5-4]
ENSMUST00000068962; ENSMUSP00000066735; ENSMUSG00000039607. [Q8BWL5-3]
ENSMUST00000111772; ENSMUSP00000107402; ENSMUSG00000039607. [Q8BWL5-2]
ENSMUST00000111773; ENSMUSP00000107403; ENSMUSG00000039607. [Q8BWL5-1]
ENSMUST00000164018; ENSMUSP00000131371; ENSMUSG00000039607. [Q8BWL5-5]
ENSMUST00000174868; ENSMUSP00000133621; ENSMUSG00000039607. [Q8BWL5-6]
GeneIDi207181.
KEGGimmu:207181.
UCSCiuc009ryv.3. mouse. [Q8BWL5-3]
uc009ryw.3. mouse. [Q8BWL5-1]
uc009ryx.3. mouse. [Q8BWL5-2]
uc009ryy.3. mouse. [Q8BWL5-6]
uc009ryz.3. mouse. [Q8BWL5-4]
uc009rza.3. mouse. [Q8BWL5-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK030478 mRNA. Translation: BAC26980.1.
AK030609 mRNA. Translation: BAC27045.1.
AK032938 mRNA. Translation: BAC28091.1.
AK033005 mRNA. Translation: BAC28122.1.
AK041098 mRNA. Translation: BAC30820.1.
AK046197 mRNA. Translation: BAC32633.1.
AK052196 mRNA. Translation: BAC34878.1. Different initiation.
BC108402 mRNA. Translation: AAI08403.1.
BC117841 mRNA. Translation: AAI17842.1.
CCDSiCCDS40798.1. [Q8BWL5-3]
CCDS52955.1. [Q8BWL5-2]
CCDS52956.1. [Q8BWL5-6]
CCDS52957.1. [Q8BWL5-1]
CCDS57711.1. [Q8BWL5-4]
CCDS57712.1. [Q8BWL5-5]
RefSeqiNP_001165592.1. NM_001172121.1. [Q8BWL5-5]
NP_001165593.1. NM_001172122.1. [Q8BWL5-2]
NP_001165594.1. NM_001172123.1. [Q8BWL5-1]
NP_001165595.1. NM_001172124.1. [Q8BWL5-6]
NP_001165597.1. NM_001172126.1. [Q8BWL5-4]
NP_848775.2. NM_178660.4. [Q8BWL5-3]
UniGeneiMm.326411.

3D structure databases

ProteinModelPortaliQ8BWL5.
SMRiQ8BWL5. Positions 45-218.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131371.

PTM databases

iPTMnetiQ8BWL5.
PhosphoSiteiQ8BWL5.

Proteomic databases

EPDiQ8BWL5.
MaxQBiQ8BWL5.
PaxDbiQ8BWL5.
PRIDEiQ8BWL5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000044901; ENSMUSP00000039706; ENSMUSG00000039607. [Q8BWL5-4]
ENSMUST00000068962; ENSMUSP00000066735; ENSMUSG00000039607. [Q8BWL5-3]
ENSMUST00000111772; ENSMUSP00000107402; ENSMUSG00000039607. [Q8BWL5-2]
ENSMUST00000111773; ENSMUSP00000107403; ENSMUSG00000039607. [Q8BWL5-1]
ENSMUST00000164018; ENSMUSP00000131371; ENSMUSG00000039607. [Q8BWL5-5]
ENSMUST00000174868; ENSMUSP00000133621; ENSMUSG00000039607. [Q8BWL5-6]
GeneIDi207181.
KEGGimmu:207181.
UCSCiuc009ryv.3. mouse. [Q8BWL5-3]
uc009ryw.3. mouse. [Q8BWL5-1]
uc009ryx.3. mouse. [Q8BWL5-2]
uc009ryy.3. mouse. [Q8BWL5-6]
uc009ryz.3. mouse. [Q8BWL5-4]
uc009rza.3. mouse. [Q8BWL5-5]

Organism-specific databases

CTDi27303.
MGIiMGI:2444477. Rbms3.

Phylogenomic databases

eggNOGiKOG4733. Eukaryota.
ENOG410XRB5. LUCA.
GeneTreeiENSGT00760000118913.
HOVERGENiHBG053108.
InParanoidiQ8BWL5.
OMAiPMYPQYT.
OrthoDBiEOG71G9V3.
PhylomeDBiQ8BWL5.
TreeFamiTF314644.

Miscellaneous databases

ChiTaRSiRbms3. mouse.
NextBioi371875.
PROiQ8BWL5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BWL5.
ExpressionAtlasiQ8BWL5. baseline and differential.
GenevisibleiQ8BWL5. MM.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR002343. Hud_Sxl_RNA.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 2 hits.
[Graphical view]
PRINTSiPR00961. HUDSXLRNA.
SMARTiSM00360. RRM. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6).
    Strain: C57BL/6J.
    Tissue: Aorta, Corpora quadrigemina, Heart, Pituitary, Vein and Wolffian duct.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Limb.

Entry informationi

Entry nameiRBMS3_MOUSE
AccessioniPrimary (citable) accession number: Q8BWL5
Secondary accession number(s): Q2VPR0
, Q8BL73, Q8BLW6, Q8BMA7, Q8BMB5, Q8BML0, Q8BMN1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: March 16, 2016
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.