Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding motif, single-stranded-interacting protein 3

Gene

Rbms3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Binds poly(A) and poly(U) oligoribonucleotides.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding motif, single-stranded-interacting protein 3
Gene namesi
Name:Rbms3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi

Organism-specific databases

MGIiMGI:2444477 Rbms3

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002749071 – 431RNA-binding motif, single-stranded-interacting protein 3Add BLAST431

Proteomic databases

PaxDbiQ8BWL5
PRIDEiQ8BWL5

PTM databases

iPTMnetiQ8BWL5
PhosphoSitePlusiQ8BWL5

Expressioni

Gene expression databases

BgeeiENSMUSG00000039607
ExpressionAtlasiQ8BWL5 baseline and differential
GenevisibleiQ8BWL5 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131371

Structurei

3D structure databases

ProteinModelPortaliQ8BWL5
SMRiQ8BWL5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini56 – 129RRM 1PROSITE-ProRule annotationAdd BLAST74
Domaini135 – 220RRM 2PROSITE-ProRule annotationAdd BLAST86

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG4733 Eukaryota
ENOG410XRB5 LUCA
GeneTreeiENSGT00760000118913
HOVERGENiHBG053108
InParanoidiQ8BWL5
OMAiHYLQTKX
OrthoDBiEOG091G0FXS
PhylomeDBiQ8BWL5
TreeFamiTF314644

Family and domain databases

CDDicd12475 RRM2_RBMS3, 1 hit
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR002343 Hud_Sxl_RNA
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR034406 RBMS3_RRM2
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 2 hits
PRINTSiPR00961 HUDSXLRNA
SMARTiView protein in SMART
SM00360 RRM, 2 hits
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 2 hits

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BWL5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKRLDQPQM YPQYTYYCPQ YLQTKQSYAP APHPMAPPSP STNSSSNSSG
60 70 80 90 100
EQLSKTNLYI RGLPPGTTDQ DLIKLCQPYG KIVSTKAILD KNTNQCKGYG
110 120 130 140 150
FVDFDSPAAA QKAVASLKAN GVQAQMAKQQ EQDPTNLYIS NLPISMDEQE
160 170 180 190 200
LENMLKPFGH VISTRILRDA NGVSRGVGFA RMESTEKCEV VIQHFNGKYL
210 220 230 240 250
KTPPGIPAPS EPLLCKFADG GQKKRQGQSK HTQNGRPWPR EGEAGMALTY
260 270 280 290 300
DPTAALQNGF YSSPYSLATN RMIPQTSITP FIAASPVSTY QVQSTSWTPH
310 320 330 340 350
LPYIMQPTGA VITPAVDHPM SMQPTNIVGP LTQQMNHLSL GTAGTIQSQD
360 370 380 390 400
RIMVLHQLLC QYMTAAPMQG TYIPQYTPVP PTAVSIEGVV ADTSPQTVAP
410 420 430
SSQDSSGQQQ QLAVDTPSEH APAYSFQQSK P
Length:431
Mass (Da):46,927
Last modified:February 6, 2007 - v2
Checksum:i65D096613FDF783A
GO
Isoform 2 (identifier: Q8BWL5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-361: Missing.

Show »
Length:415
Mass (Da):45,020
Checksum:i58C0229A95698D24
GO
Isoform 3 (identifier: Q8BWL5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     292-308: Missing.

Show »
Length:414
Mass (Da):44,959
Checksum:i5EC4B16CBE0A3A1A
GO
Isoform 4 (identifier: Q8BWL5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-361: Missing.
     388-431: GVVADTSPQTVAPSSQDSSGQQQQLAVDTPSEHAPAYSFQQSKP → TIDRSEDVCLNLYLQ

Show »
Length:386
Mass (Da):42,244
Checksum:iFFF527486383B871
GO
Isoform 5 (identifier: Q8BWL5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGKRLDQPQMYPQYTYYCPQYLQTKQ → MEGGRLLIRS...SYTYCTGHPV
     292-308: Missing.

Show »
Length:463
Mass (Da):50,004
Checksum:i7AD6BA9A8BA0D5AF
GO
Isoform 6 (identifier: Q8BWL5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-431: GVVADTSPQTVAPSSQDSSGQQQQLAVDTPSEHAPAYSFQQSKP → TIDRSEDVCLNLYLQ

Show »
Length:402
Mass (Da):44,151
Checksum:i2817B4A05DBF50A4
GO

Sequence cautioni

The sequence BAC34878 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti10M → I in BAC26980 (PubMed:16141072).Curated1
Sequence conflicti20Q → H in BAC26980 (PubMed:16141072).Curated1
Sequence conflicti309G → S in AAI08403 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0229321 – 26MGKRL…LQTKQ → MEGGRLLIRSNANGVTQSNS TVRAYQSSKSRVTMSPGFSS QWSNSQPAWNTYSFPRASLH YQSHASYTYCTGHPV in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_022933292 – 308Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_022934346 – 361Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_022935388 – 431GVVAD…QQSKP → TIDRSEDVCLNLYLQ in isoform 4 and isoform 6. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK030478 mRNA Translation: BAC26980.1
AK030609 mRNA Translation: BAC27045.1
AK032938 mRNA Translation: BAC28091.1
AK033005 mRNA Translation: BAC28122.1
AK041098 mRNA Translation: BAC30820.1
AK046197 mRNA Translation: BAC32633.1
AK052196 mRNA Translation: BAC34878.1 Different initiation.
BC108402 mRNA Translation: AAI08403.1
BC117841 mRNA Translation: AAI17842.1
CCDSiCCDS40798.1 [Q8BWL5-3]
CCDS52955.1 [Q8BWL5-2]
CCDS52956.1 [Q8BWL5-6]
CCDS52957.1 [Q8BWL5-1]
CCDS57711.1 [Q8BWL5-4]
CCDS57712.1 [Q8BWL5-5]
RefSeqiNP_001165592.1, NM_001172121.1 [Q8BWL5-5]
NP_001165593.1, NM_001172122.1 [Q8BWL5-2]
NP_001165594.1, NM_001172123.1 [Q8BWL5-1]
NP_001165595.1, NM_001172124.1 [Q8BWL5-6]
NP_001165597.1, NM_001172126.1 [Q8BWL5-4]
NP_848775.2, NM_178660.4 [Q8BWL5-3]
UniGeneiMm.326411

Genome annotation databases

EnsembliENSMUST00000044901; ENSMUSP00000039706; ENSMUSG00000039607 [Q8BWL5-4]
ENSMUST00000068962; ENSMUSP00000066735; ENSMUSG00000039607 [Q8BWL5-3]
ENSMUST00000111772; ENSMUSP00000107402; ENSMUSG00000039607 [Q8BWL5-2]
ENSMUST00000111773; ENSMUSP00000107403; ENSMUSG00000039607 [Q8BWL5-1]
ENSMUST00000164018; ENSMUSP00000131371; ENSMUSG00000039607 [Q8BWL5-5]
ENSMUST00000174868; ENSMUSP00000133621; ENSMUSG00000039607 [Q8BWL5-6]
GeneIDi207181
KEGGimmu:207181
UCSCiuc009ryv.3 mouse [Q8BWL5-3]
uc009ryw.3 mouse [Q8BWL5-1]
uc009ryx.3 mouse [Q8BWL5-2]
uc009ryy.3 mouse [Q8BWL5-6]
uc009ryz.3 mouse [Q8BWL5-4]
uc009rza.3 mouse [Q8BWL5-5]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRBMS3_MOUSE
AccessioniPrimary (citable) accession number: Q8BWL5
Secondary accession number(s): Q2VPR0
, Q8BL73, Q8BLW6, Q8BMA7, Q8BMB5, Q8BML0, Q8BMN1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: March 28, 2018
This is version 112 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health