Q8BW96 (KCC1D_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium/calmodulin-dependent protein kinase type 1D EC=2.7.11.17 Alternative name(s): CaM kinase I delta Short name=CaM-KI delta Short name=CaMKI delta CaM kinase ID CaMKI-like protein kinase Short name=CKLiK Short name=mCKLiK | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 385 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Activates the transcription factor CREB1 in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta By similarity. Isoform 1 but not isoform 2 activates CREB1. Ref.1 Ref.4 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Activated by Ca2+/calmodulin. Binding of calmodulin results in conformational change that relieves intrasteric autoinhibition and allows phosphorylation of Thr-180 within the activation loop by CaMKK1 or CaMKK2. Phosphorylation of Thr-180 results in several fold increase in total activity. Unlike CaMK4, may be unable to exhibit autonomous activity after Ca2+/calmodulin activation By similarity. |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: Predominantly cytoplasmic By similarity. Nuclear upon activation By similarity. |
| Tissue specificity | Expressed ubiquitously with high levels in brain and low levels in kidney. Isoform 2 is highly expressed in brain compared to other tissues. In hematopoietic cell lines predominant expression was detected in T and EC cells. Ref.1 |
| Developmental stage | In EML cell line differentiation, expression increases 4 to 8 hours after treatment with all-trans retinoic acid (ATRA) and then declines after 24 hours of ATRA induction. Ref.4 |
| Induction | Down-regulated upon cholesterol-rich diet. Ref.2 |
| Domain | The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8BW96-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8BW96-2) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 333-385: ASVSSNLSLA...TVTTGHTGSK → VWHLPRSVVSFLLRRGSQESELRGDPQPPL | ||||||
| Note: Inactive. Does not activate CREB1. | ||||||
| Isoform 3 (identifier: Q8BW96-3) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MARENGESSSSWKKQAEDIKKIFEFKETLGT → MAEFVSWSCLNFRWSWIKGSRNS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 385 | 385 | Calcium/calmodulin-dependent protein kinase type 1D | PRO_0000086083 | |||||
Regions | |||||||||
| Domain | 23 – 279 | 257 | Protein kinase | ||||||
| Nucleotide binding | 29 – 37 | 9 | ATP By similarity | ||||||
| Region | 279 – 319 | 41 | Autoinhibitory domain By similarity | ||||||
| Region | 299 – 320 | 22 | Calmodulin-binding By similarity | ||||||
| Motif | 318 – 324 | 7 | Nuclear export signal By similarity | ||||||
Sites | |||||||||
| Active site | 144 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 52 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 122 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 180 | 1 | Phosphothreonine; by CaMKK1 and CaMKK2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 31 | 31 | MAREN…ETLGT → MAEFVSWSCLNFRWSWIKGS RNS in isoform 3. | VSP_012136 | |||||
| Alternative sequence | 333 – 385 | 53 | ASVSS…HTGSK → VWHLPRSVVSFLLRRGSQES ELRGDPQPPL in isoform 2. | VSP_012137 | |||||
Experimental info | |||||||||
| Mutagenesis | 52 | 1 | K → D: Catalytically inactive form. | ||||||
| Mutagenesis | 289 – 292 | 4 | IHES → DEDD: Constitutively active form; when associated with A-301. Ref.4 | ||||||
| Mutagenesis | 301 | 1 | F → A: Constitutively active form; when associated with 289-A--A-292. Ref.4 | ||||||
| Sequence conflict | 30 | 1 | G → Q in BAC35295. Ref.3 | ||||||
| Sequence conflict | 327 | 1 | S → N in BAC35295. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Effects of PU.1-induced mouse calcium-calmodulin-dependent kinase I-like kinase (CKLiK) on apoptosis of murine erythroleukemia cells." Yamada T., Suzuki M., Satoh H., Kihara-Negishi F., Nakano H., Oikawa T. Exp. Cell Res. 294:39-50(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Novel putative SREBP and LXR target genes identified by microarray analysis in liver of cholesterol-fed mice." Maxwell K.N., Soccio R.E., Duncan E.M., Sehayek E., Breslow J.L. J. Lipid Res. 44:2109-2119(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INDUCTION. Strain: C57BL/6. Tissue: Liver. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J and NOD. Tissue: Brain and Lung. |
| [4] | "A cascade of Ca(2+)/calmodulin-dependent protein kinases regulates the differentiation and functional activation of murine neutrophils." Gaines P., Lamoureux J., Marisetty A., Chi J., Berliner N. Exp. Hematol. 36:832-844(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE, MUTAGENESIS OF 289-ILE--SER-292 AND PHE-301. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY273822 mRNA. Translation: AAP31673.1. AK052401 mRNA. Translation: BAC34975.1. AK053173 mRNA. Translation: BAC35295.1. AK147616 mRNA. Translation: BAE28027.1. AK154434 mRNA. Translation: BAE32584.1. AK170777 mRNA. Translation: BAE42022.1. |
| IPI | IPI00226188. IPI00403595. IPI00480395. |
| RefSeq | NP_796317.2. NM_177343.3. |
| UniGene | Mm.191949. |
3D structure databases | |
| ProteinModelPortal | Q8BW96. |
| SMR | Q8BW96. Positions 11-334. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8BW96. 1 interaction. |
PTM databases | |
| PhosphoSite | Q8BW96. |
Proteomic databases | |
| PaxDb | Q8BW96. |
| PRIDE | Q8BW96. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000044009; ENSMUSP00000037028; ENSMUSG00000039145. ENSMUST00000114987; ENSMUSP00000110638; ENSMUSG00000039145. |
| GeneID | 227541. |
| KEGG | mmu:227541. |
Organism-specific databases | |
| CTD | 57118. |
| MGI | MGI:2442190. Camk1d. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00670000097661. |
| HOGENOM | HOG000233016. |
| HOVERGEN | HBG108055. |
| InParanoid | Q8BW96. |
| KO | K08794. |
| OMA | ETFEDKS. |
Gene expression databases | |
| ArrayExpress | Q8BW96. |
| Bgee | Q8BW96. |
| CleanEx | MM_CAMK1D. |
| Genevestigator | Q8BW96. |
| GermOnline | ENSMUSG00000039145. Mus musculus. |
Family and domain databases | |
| InterPro | IPR020636. Ca/CaM-dep_Ca-dep_prot_Kinase. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| PANTHER | PTHR24347. PTHR24347. 1 hit. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CAMK1D. mouse. |
| NextBio | 378629. |
| SOURCE | Search... |
Entry information
| Entry name | KCC1D_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8BW96 Secondary accession number(s): Q3U450, Q80W64, Q8BWI7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
