Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8BW96

- KCC1D_MOUSE

UniProt

Q8BW96 - KCC1D_MOUSE

Protein

Calcium/calmodulin-dependent protein kinase type 1D

Gene

Camk1d

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 2 (07 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respiratory burst and promotes basal dendritic growth of hippocampal neurons. In neutrophil cells, required for cytokine-induced proliferative responses and activation of the respiratory burst. Activates the transcription factor CREB1 in hippocampal neuron nuclei. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta By similarity. Isoform 1 but not isoform 2 activates CREB1.By similarity2 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Enzyme regulationi

    Activated by Ca2+/calmodulin. Binding of calmodulin results in conformational change that relieves intrasteric autoinhibition and allows phosphorylation of Thr-180 within the activation loop by CaMKK1 or CaMKK2. Phosphorylation of Thr-180 results in several fold increase in total activity. Unlike CaMK4, may be unable to exhibit autonomous activity after Ca2+/calmodulin activation By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei52 – 521ATPPROSITE-ProRule annotation
    Active sitei144 – 1441Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi29 – 379ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. calmodulin-dependent protein kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. inflammatory response Source: UniProtKB-KW
    2. negative regulation of apoptotic process Source: MGI
    3. positive regulation of apoptotic process Source: MGI
    4. positive regulation of CREB transcription factor activity Source: UniProtKB
    5. positive regulation of neuron projection development Source: UniProtKB
    6. positive regulation of neutrophil chemotaxis Source: UniProtKB
    7. positive regulation of phagocytosis Source: UniProtKB
    8. positive regulation of respiratory burst Source: UniProtKB
    9. regulation of dendrite development Source: UniProtKB
    10. regulation of granulocyte chemotaxis Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Biological processi

    Inflammatory response, Neurogenesis

    Keywords - Ligandi

    ATP-binding, Calcium, Calmodulin-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium/calmodulin-dependent protein kinase type 1D (EC:2.7.11.17)
    Alternative name(s):
    CaM kinase I delta
    Short name:
    CaM-KI delta
    Short name:
    CaMKI delta
    CaM kinase ID
    CaMKI-like protein kinase
    Short name:
    CKLiK
    Short name:
    mCKLiK
    Gene namesi
    Name:Camk1d
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:2442190. Camk1d.

    Subcellular locationi

    Cytoplasm By similarity. Nucleus By similarity
    Note: Predominantly cytoplasmic. Nuclear upon activation.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi52 – 521K → D: Catalytically inactive form.
    Mutagenesisi289 – 2924IHES → DEDD: Constitutively active form; when associated with A-301.
    Mutagenesisi301 – 3011F → A: Constitutively active form; when associated with 289-A--A-292. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 385385Calcium/calmodulin-dependent protein kinase type 1DPRO_0000086083Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei122 – 1221PhosphoserineBy similarity
    Modified residuei180 – 1801Phosphothreonine; by CaMKK1 and CaMKK2By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8BW96.
    PaxDbiQ8BW96.
    PRIDEiQ8BW96.

    PTM databases

    PhosphoSiteiQ8BW96.

    Expressioni

    Tissue specificityi

    Expressed ubiquitously with high levels in brain and low levels in kidney. Isoform 2 is highly expressed in brain compared to other tissues. In hematopoietic cell lines predominant expression was detected in T and EC cells.1 Publication

    Developmental stagei

    In EML cell line differentiation, expression increases 4 to 8 hours after treatment with all-trans retinoic acid (ATRA) and then declines after 24 hours of ATRA induction.1 Publication

    Inductioni

    Down-regulated upon cholesterol-rich diet.1 Publication

    Gene expression databases

    ArrayExpressiQ8BW96.
    BgeeiQ8BW96.
    CleanExiMM_CAMK1D.
    GenevestigatoriQ8BW96.

    Interactioni

    Protein-protein interaction databases

    BioGridi230634. 1 interaction.
    IntActiQ8BW96. 2 interactions.
    MINTiMINT-4099544.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8BW96.
    SMRiQ8BW96. Positions 11-334.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini23 – 279257Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni279 – 31941Autoinhibitory domainBy similarityAdd
    BLAST
    Regioni299 – 32022Calmodulin-bindingBy similarityAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi318 – 3247Nuclear export signalBy similarity

    Domaini

    The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.By similarity

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    GeneTreeiENSGT00740000115341.
    HOGENOMiHOG000233016.
    HOVERGENiHBG108055.
    InParanoidiQ8BW96.
    KOiK08794.
    OMAiPYWDQIS.
    OrthoDBiEOG7WHH9K.
    PhylomeDBiQ8BW96.
    TreeFamiTF314166.

    Family and domain databases

    InterProiIPR020636. Ca/CaM-dep_Ca-dep_prot_Kinase.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PANTHERiPTHR24347. PTHR24347. 1 hit.
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8BW96-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARENGESSS SWKKQAEDIK KIFEFKETLG TGAFSEVVLA EEKATGKLFA    50
    VKCIPKKALK GKESSIENEI AVLRKIKHEN IVALEDIYES PNHLYLVMQL 100
    VSGGELFDRI VEKGFYTEKD ASTLIRQVLD AVYYLHRMGI VHRDLKPENL 150
    LYYSQDEESK IMISDFGLSK MEGKGDVMST ACGTPGYVAP EVLAQKPYSK 200
    AVDCWSIGVI AYILLCGYPP FYDENDSKLF EQILKAEYEF DSPYWDDISD 250
    SAKDFIRNLM EKDPNKRYTC EQAARHPWIA GDTALSKNIH ESVSAQIRKN 300
    FAKSKWRQAF NATAVVRHMR RLQLGSSLDS SNASVSSNLS LASQKDCLAP 350
    STLCSFLSSS SGVAGVGAER RPRPTTVTTG HTGSK 385
    Length:385
    Mass (Da):42,919
    Last modified:December 7, 2004 - v2
    Checksum:i320EB0D3D5670055
    GO
    Isoform 2 (identifier: Q8BW96-2) [UniParc]FASTAAdd to Basket

    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         333-385: ASVSSNLSLA...TVTTGHTGSK → VWHLPRSVVSFLLRRGSQESELRGDPQPPL

    Note: Inactive. Does not activate CREB1.

    Show »
    Length:362
    Mass (Da):41,110
    Checksum:iF3D0573864293BF5
    GO
    Isoform 3 (identifier: Q8BW96-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MARENGESSSSWKKQAEDIKKIFEFKETLGT → MAEFVSWSCLNFRWSWIKGSRNS

    Show »
    Length:377
    Mass (Da):42,135
    Checksum:iBAC17016D8CF9F91
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti30 – 301G → Q in BAC35295. (PubMed:16141072)Curated
    Sequence conflicti327 – 3271S → N in BAC35295. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3131MAREN…ETLGT → MAEFVSWSCLNFRWSWIKGS RNS in isoform 3. 1 PublicationVSP_012136Add
    BLAST
    Alternative sequencei333 – 38553ASVSS…HTGSK → VWHLPRSVVSFLLRRGSQES ELRGDPQPPL in isoform 2. 1 PublicationVSP_012137Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY273822 mRNA. Translation: AAP31673.1.
    AK052401 mRNA. Translation: BAC34975.1.
    AK053173 mRNA. Translation: BAC35295.1.
    AK147616 mRNA. Translation: BAE28027.1.
    AK154434 mRNA. Translation: BAE32584.1.
    AK170777 mRNA. Translation: BAE42022.1.
    CCDSiCCDS15665.1. [Q8BW96-1]
    CCDS70975.1. [Q8BW96-3]
    RefSeqiNP_001277303.1. NM_001290374.1.
    NP_001277304.1. NM_001290375.1.
    NP_001277305.1. NM_001290376.1. [Q8BW96-3]
    NP_796317.2. NM_177343.4. [Q8BW96-1]
    UniGeneiMm.191949.

    Genome annotation databases

    EnsembliENSMUST00000044009; ENSMUSP00000037028; ENSMUSG00000039145. [Q8BW96-1]
    ENSMUST00000114987; ENSMUSP00000110638; ENSMUSG00000039145. [Q8BW96-3]
    GeneIDi227541.
    KEGGimmu:227541.
    UCSCiuc008ifp.1. mouse. [Q8BW96-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY273822 mRNA. Translation: AAP31673.1 .
    AK052401 mRNA. Translation: BAC34975.1 .
    AK053173 mRNA. Translation: BAC35295.1 .
    AK147616 mRNA. Translation: BAE28027.1 .
    AK154434 mRNA. Translation: BAE32584.1 .
    AK170777 mRNA. Translation: BAE42022.1 .
    CCDSi CCDS15665.1. [Q8BW96-1 ]
    CCDS70975.1. [Q8BW96-3 ]
    RefSeqi NP_001277303.1. NM_001290374.1.
    NP_001277304.1. NM_001290375.1.
    NP_001277305.1. NM_001290376.1. [Q8BW96-3 ]
    NP_796317.2. NM_177343.4. [Q8BW96-1 ]
    UniGenei Mm.191949.

    3D structure databases

    ProteinModelPortali Q8BW96.
    SMRi Q8BW96. Positions 11-334.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 230634. 1 interaction.
    IntActi Q8BW96. 2 interactions.
    MINTi MINT-4099544.

    PTM databases

    PhosphoSitei Q8BW96.

    Proteomic databases

    MaxQBi Q8BW96.
    PaxDbi Q8BW96.
    PRIDEi Q8BW96.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000044009 ; ENSMUSP00000037028 ; ENSMUSG00000039145 . [Q8BW96-1 ]
    ENSMUST00000114987 ; ENSMUSP00000110638 ; ENSMUSG00000039145 . [Q8BW96-3 ]
    GeneIDi 227541.
    KEGGi mmu:227541.
    UCSCi uc008ifp.1. mouse. [Q8BW96-1 ]

    Organism-specific databases

    CTDi 57118.
    MGIi MGI:2442190. Camk1d.

    Phylogenomic databases

    eggNOGi COG0515.
    GeneTreei ENSGT00740000115341.
    HOGENOMi HOG000233016.
    HOVERGENi HBG108055.
    InParanoidi Q8BW96.
    KOi K08794.
    OMAi PYWDQIS.
    OrthoDBi EOG7WHH9K.
    PhylomeDBi Q8BW96.
    TreeFami TF314166.

    Miscellaneous databases

    ChiTaRSi CAMK1D. mouse.
    NextBioi 378629.
    PROi Q8BW96.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8BW96.
    Bgeei Q8BW96.
    CleanExi MM_CAMK1D.
    Genevestigatori Q8BW96.

    Family and domain databases

    InterProi IPR020636. Ca/CaM-dep_Ca-dep_prot_Kinase.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    PANTHERi PTHR24347. PTHR24347. 1 hit.
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Effects of PU.1-induced mouse calcium-calmodulin-dependent kinase I-like kinase (CKLiK) on apoptosis of murine erythroleukemia cells."
      Yamada T., Suzuki M., Satoh H., Kihara-Negishi F., Nakano H., Oikawa T.
      Exp. Cell Res. 294:39-50(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY.
    2. "Novel putative SREBP and LXR target genes identified by microarray analysis in liver of cholesterol-fed mice."
      Maxwell K.N., Soccio R.E., Duncan E.M., Sehayek E., Breslow J.L.
      J. Lipid Res. 44:2109-2119(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INDUCTION.
      Strain: C57BL/6.
      Tissue: Liver.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J and NOD.
      Tissue: Brain and Lung.
    4. "A cascade of Ca(2+)/calmodulin-dependent protein kinases regulates the differentiation and functional activation of murine neutrophils."
      Gaines P., Lamoureux J., Marisetty A., Chi J., Berliner N.
      Exp. Hematol. 36:832-844(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DEVELOPMENTAL STAGE, MUTAGENESIS OF 289-ILE--SER-292 AND PHE-301.

    Entry informationi

    Entry nameiKCC1D_MOUSE
    AccessioniPrimary (citable) accession number: Q8BW96
    Secondary accession number(s): Q3U450, Q80W64, Q8BWI7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: December 7, 2004
    Last modified: October 1, 2014
    This is version 110 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Allosteric enzyme, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3