Reviewed,
UniProtKB/Swiss-Prot Q8BW96 (KCC1D_MOUSE)
Last modified
November 3, 2009.
Version 63.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Calcium/calmodulin-dependent protein kinase type 1D EC=2.7.11.17 Alternative name(s): CaM kinase ID CaM kinase I delta Short name=CaM-KI delta Short name=CaMKI-delta Short name=CaMKI delta Camk1D CamKI-like protein kinase Short name=mCKLiK Short name=CKLiK | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 385 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May regulate calcium-mediated granulocyte function. May play a role in apoptosis of erythroleukemia cells. Activates MAP kinase MAPK3 By similarity. In vitro, phosphorylates transcription factor CREM isoform Beta and probably CREB1 By similarity. Isoform 1 but not isoform 2 activates CREB1. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Activated by Ca2+/calmodulin. Binding of calmodulin is thought to result in a conformational change and can lead to subsequent activation through phosphorylation by CAMKK1 and CAMKK2. At least in part, also activated by CAMKK1 in a calcium-independent manner By similarity. |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: Predominantly cytoplasmic By similarity. Nuclear upon activation By similarity. |
| Tissue specificity | Expressed ubiquitously with high levels in brain and low levels in kidney. Isoform 2 is highly expressed in brain compared to other tissues. In hematopoietic cell lines predominant expression was detected in T and EC cells. Ref.1 |
| Induction | Down-regulated upon cholesterol-rich diet. Ref.2 |
| Domain | The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Calcium Calmodulin-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Allosteric enzyme |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Inferred from electronic annotation. Source: InterPro regulation of apoptosis Ref.1Inferred from direct assay. Source: MGI |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW calcium ion bindingInferred from electronic annotation. Source: UniProtKB-KW calmodulin bindingInferred from electronic annotation. Source: UniProtKB-KW calmodulin-dependent protein kinase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8BW96-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8BW96-2) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 333-385: ASVSSNLSLA...TVTTGHTGSK → VWHLPRSVVSFLLRRGSQESELRGDPQPPL | ||||||
| Note: Inactive. Does not activate CREB1. | ||||||
| Isoform 3 (identifier: Q8BW96-3) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MARENGESSSSWKKQAEDIKKIFEFKETLGT → MAEFVSWSCLNFRWSWIKGSRNS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 385 | 385 | Calcium/calmodulin-dependent protein kinase type 1D | PRO_0000086083 | |||||
Regions | |||||||||
| Domain | 23 – 279 | 257 | Protein kinase | ||||||
| Nucleotide binding | 29 – 37 | 9 | ATP By similarity | ||||||
| Region | 279 – 319 | 41 | Autoinhibitory domain By similarity | ||||||
| Region | 299 – 320 | 22 | Calmodulin-binding By similarity | ||||||
| Motif | 318 – 324 | 7 | Nuclear export signal By similarity | ||||||
Sites | |||||||||
| Active site | 144 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 52 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 122 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 180 | 1 | Phosphothreonine; by CaMKK1, CaMKK2 and autocatalysis By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 31 | 31 | MAREN…ETLGT → MAEFVSWSCLNFRWSWIKGS RNS in isoform 3. | VSP_012136 | |||||
| Alternative sequence | 333 – 385 | 53 | ASVSS…HTGSK → VWHLPRSVVSFLLRRGSQES ELRGDPQPPL in isoform 2. | VSP_012137 | |||||
Experimental info | |||||||||
| Sequence conflict | 30 | 1 | G → Q in BAC35295. Ref.3 | ||||||
| Sequence conflict | 327 | 1 | S → N in BAC35295. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Effects of PU.1-induced mouse calcium-calmodulin-dependent kinase I-like kinase (CKLiK) on apoptosis of murine erythroleukemia cells." Yamada T., Suzuki M., Satoh H., Kihara-Negishi F., Nakano H., Oikawa T. Exp. Cell Res. 294:39-50(2004) [PubMed: 14980499] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Novel putative SREBP and LXR target genes identified by microarray analysis in liver of cholesterol-fed mice." Maxwell K.N., Soccio R.E., Duncan E.M., Sehayek E., Breslow J.L. J. Lipid Res. 44:2109-2119(2003) [PubMed: 12897189] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INDUCTION. Strain: C57BL/6. Tissue: Liver. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J and NOD. Tissue: Brain and Lung. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AY273822 mRNA. Translation: AAP31673.1. AK052401 mRNA. Translation: BAC34975.1. AK053173 mRNA. Translation: BAC35295.1. AK147616 mRNA. Translation: BAE28027.1. AK154434 mRNA. Translation: BAE32584.1. AK170777 mRNA. Translation: BAE42022.1. | |
| IPI | IPI00226188. IPI00403595. IPI00480395. |
| RefSeq | NP_796317.2. |
| UniGene | Mm.191949 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1A06 based on UniProtKB Q63450. |
| SMR | Q8BW96. Positions 11-313. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8BW96. |
PTM databases | |
| PhosphoSite | Q8BW96. |
Proteomic databases | |
| PRIDE | Q8BW96. |
Genome annotation databases | |
| Ensembl | ENSMUST00000044009; ENSMUSP00000037028; ENSMUSG00000039145; Mus musculus. [Genome view] ENSMUST00000114987; ENSMUSP00000110638; ENSMUSG00000039145; Mus musculus. [Genome view] |
| GeneID | 227541. |
| KEGG | mmu:227541. |
| NMPDR | fig|10090.3.peg.5372. |
| UCSC | uc008ifp.1. mouse. uc008ifr.1. mouse. |
Organism-specific databases | |
| CTD | 227541. |
| MGI | MGI:2442190. Camk1d. |
Phylogenomic databases | |
| HOGENOM | Q8BW96. |
| HOVERGEN | Q8BW96. |
| OMA | VTTVHSG. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.17. 244. |
Gene expression databases | |
| ArrayExpress | Q8BW96. |
| Bgee | Q8BW96. |
| CleanEx | MM_CAMK1D. |
| Genevestigator | Q8BW96. |
| GermOnline | ENSMUSG00000039145. Mus musculus. |
Family and domain databases | |
| InterPro | IPR015734. Ca/calmodulin-dep_kinase_1. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| PANTHER | PTHR22982:SF34. CaMKI. 1 hit. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 378629. |
| SOURCE | Search... |
Entry information
| Entry name | KCC1D_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8BW96 Secondary accession number(s): Q3U450, Q80W64, Q8BWI7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


