Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dynein heavy chain 3, axonemal

Gene

Dnah3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1396 – 14038ATPSequence analysis
Nucleotide bindingi1677 – 16848ATPSequence analysis
Nucleotide bindingi2041 – 20488ATPSequence analysis
Nucleotide bindingi2401 – 24088ATPSequence analysis

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein heavy chain 3, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 3
Ciliary dynein heavy chain 3
Gene namesi
Name:Dnah3
Synonyms:Dnahc3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2683040. Dnah3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 40834083Dynein heavy chain 3, axonemalPRO_0000322545Add
BLAST

Proteomic databases

PaxDbiQ8BW94.
PRIDEiQ8BW94.

PTM databases

PhosphoSiteiQ8BW94.

Expressioni

Gene expression databases

BgeeiQ8BW94.
CleanExiMM_DNAHC3.

Interactioni

Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000042857.

Structurei

3D structure databases

ProteinModelPortaliQ8BW94.
SMRiQ8BW94. Positions 2678-2931, 3529-3736.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 13571357StemBy similarityAdd
BLAST
Regioni1358 – 1579222AAA 1By similarityAdd
BLAST
Regioni1639 – 1870232AAA 2By similarityAdd
BLAST
Regioni2003 – 2251249AAA 3By similarityAdd
BLAST
Regioni2362 – 2613252AAA 4By similarityAdd
BLAST
Regioni2628 – 2927300StalkBy similarityAdd
BLAST
Regioni3012 – 3242231AAA 5By similarityAdd
BLAST
Regioni3455 – 3679225AAA 6By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1026 – 105227Sequence analysisAdd
BLAST
Coiled coili1108 – 113326Sequence analysisAdd
BLAST
Coiled coili2651 – 271464Sequence analysisAdd
BLAST

Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3595. Eukaryota.
COG5245. LUCA.
GeneTreeiENSGT00760000118964.
HOGENOMiHOG000237308.
HOVERGENiHBG107830.
InParanoidiQ8BW94.
OMAiKEKSTYP.
OrthoDBiEOG7BW0HH.
PhylomeDBiQ8BW94.
TreeFamiTF316836.

Family and domain databases

Gene3Di3.40.50.300. 5 hits.
InterProiIPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 2 hits.
PfamiPF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 5 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BW94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDTNCSAQK LDKSDSVHHM SHSQARPELP PLPVSANEEP SELYKTVMSH
60 70 80 90 100
SFYPPLMQRT SWTLAVPFKE QDHHRGPSDS IGNNYSLTAR DMKLKDLLKV
110 120 130 140 150
YQPVTISIPR DKTSQGLPLG TSSKTSTEPS KKKMKFNLKA KDDVTGMPFV
160 170 180 190 200
CKFSSSLSIK NTTDSSVTHP ESRPMSPEQQ MDVMLQQEME IESKEQKPSE
210 220 230 240 250
LDLERYYYYL TNGIRKDMIA PENEEVMMRI YKLIPKTLLT TPALEPLQVS
260 270 280 290 300
LRSEKESDYY YSLMKSIVDY ILMDPMEKKR LFIKSIPRLF PHRVIRAPVP
310 320 330 340 350
WHNIYQSTKK WNEEHLHTVN PMMYKLKELW FAEFQNLRFV RTADLLAGKL
360 370 380 390 400
PLLPHEYKEV VQKHCREARH ILLTKWIPTC AQLFVTQKEH WVHFAPKNDY
410 420 430 440 450
DSSRNIEEYF ASVASFMSLQ LRDLVIKSLR DLVSFFMIHK DGNDFKEPYQ
460 470 480 490 500
EMDFFIPQLI MIKLEVRDPI IVFNPTFDDC WQLIKNSFLE IIKNSDGIPK
510 520 530 540 550
VYLCWKPLAS YICVSPHLRM TSVLQVESIL FPDLKGYNMI LGTVNPEESL
560 570 580 590 600
VSDFLDQTLE VFKKNQVGPY KYLNVYKKYD DLLDNMAEKG ISEFLKEKHE
610 620 630 640 650
IEDFVTSINS IKKRKNEIAS MHITVPLAMF CLDAVFLNYD LCERAQNLKD
660 670 680 690 700
NLILYQVDVN RETNTSICNQ YSTIADKVSE IPANTAELVA LIEYLKKSSD
710 720 730 740 750
VTVFKLRRQL RDASERLEFL MDYADLPSES IEDVFESSRN LLMSKRDQAE
760 770 780 790 800
MDLIKRCSEF ESRLEGYSKE LEMFRKREVM TTEEMKNNVE KLHDLSKNLD
810 820 830 840 850
LALTEFELIN KEEELLEKEK SSFPLLQTLM INKIPYEQLW VTAYEFSTKS
860 870 880 890 900
EEWMNGPLYL MNAEQIAEEI GNMWRTTYKL TKTLIDVPAP KRLAENVKLK
910 920 930 940 950
IEKFKQHIPI LNIACNPGMK DRHWQQISDI VGYEIKPTET TCLANMLEYG
960 970 980 990 1000
FGKFVDKLEP IGAAASKEYS LEKNLEKMKA DWVNMCFSFV KYRDTDTSIL
1010 1020 1030 1040 1050
CAVDDIQLIL DDHVIKTQTM CGSVFIKPIE AECRKWEEKL VRVQENLDAW
1060 1070 1080 1090 1100
LKCQVTWLYL EPIFSSEDII AQMPEEGKKF TTVDTYWKSL MAQAVNDTRV
1110 1120 1130 1140 1150
MVAADQPRMT EKLQEANVLL EDIQRGLNDY LEKKRLFFPR FFFLSNDELL
1160 1170 1180 1190 1200
EILSETKDPL RVQPHLKKCF EGIAKLEFTD NLEIKGMISS EKETVPFIQT
1210 1220 1230 1240 1250
IYPVKAKGMV EKWLQQVEQV MLASMRQVIE NGIEAYVQVP RNAWVLEWPG
1260 1270 1280 1290 1300
QVVICVSSIF WTREVSEALV EDTLTDFLKK SNDQIAQIVE LVRGKLSSGA
1310 1320 1330 1340 1350
RLTLGALTVI DVHARDVVAK LRHDHINSLN DFQWISQLRY YWTEKNVHVQ
1360 1370 1380 1390 1400
MITTEALYGY EYLGNSPRLV ITPLTDRCYR TLMGALKLNL GGAPEGPAGT
1410 1420 1430 1440 1450
GKTETTKDLA KALAKQCVVF NCSDGLDYKA MGKFFKGLAQ AGAWACFDEF
1460 1470 1480 1490 1500
NRIEVEVLSV VAQQILSIQQ AIIRKLKRFI FEGTELSLNP TCAVFITMNP
1510 1520 1530 1540 1550
GYAGRAELPD NLKALFRTVA MMVPDYALIG EISLYSMGFL DSRSLAQKIV
1560 1570 1580 1590 1600
ATYRLCSEQL SSQHHYDYGM RAVKSVLTAA GNLKLKYPEE NESVLLLRAL
1610 1620 1630 1640 1650
LDVNLAKFLA QDVPLFQGII SDLFPGVVLP KPDYEVFLEA LNNNIRKMKL
1660 1670 1680 1690 1700
QPVPWFIGKI IQIYEMMLVR HGYMIVGDPM GGKTSAYKVL AAALGDLHAA
1710 1720 1730 1740 1750
NQMEEFAVEF KIINPKAITM GQLYGCFDAV SHEWTDGVLA NAFREQASSI
1760 1770 1780 1790 1800
TDDRKWIIFD GPVDAVWIEN MNTVLDDNKK LCLMSGEIIQ MSSKMSLIFE
1810 1820 1830 1840 1850
PADLEQASPA TVSRCGMIYM EAHQLGWKPL KDSYMDTLPR CLTKEHTELV
1860 1870 1880 1890 1900
EDMFTWLVQP CLDFSRLHCK FVVQTSPIHL AFSMMRLYSS LLDEIRDIQE
1910 1920 1930 1940 1950
EEMEIYEGLS SQQIFLWLQG LFLFSLVWTL AGTINAESRK KFDVFFRNLI
1960 1970 1980 1990 2000
MGMDDRNPRP KSVKLTKNNI FPERGSIYDF YFLKQGGGHW NAWTEYITKE
2010 2020 2030 2040 2050
EETIPANAKV SDLIIPTMET ARQSFFLKTY LDHEIPILFV GPTGTGKSAI
2060 2070 2080 2090 2100
TNDFLLHLPK NVYQPNFINF SARTSANQTQ DIIMSKLDRR RKGLFGPPIG
2110 2120 2130 2140 2150
KKAVVFVDDL NMPAKEVYGA QPPIELLRQW IDHGYWFDKK DTNRLDIVDV
2160 2170 2180 2190 2200
LLVTAMGPPG GGRNDITGRF TRHLNIISIN AFEDEILTKI FSSIADWHFG
2210 2220 2230 2240 2250
KGFDVMFLRY GKMLVQATQT IYRAAVENFL PTPSKSHYVF NLRDFSRVIQ
2260 2270 2280 2290 2300
GVLLCPHTHL QDLEKFIRLW IHEVYRVFYD RLIDNDDRQT FFNLVKETTS
2310 2320 2330 2340 2350
NCFKQTMEKV LIHLSPTGKI TDDNIRSLFF GDYLKPESDQ KIYDEIIDLR
2360 2370 2380 2390 2400
GLTVVMEYYL DEFNSVSKAP MSLVMFKFAI EHISRICRVL KQKKGHLLLV
2410 2420 2430 2440 2450
GIGGSGRQSA TKLSTFMNSY ELYQIEITKN YTNSDWREDL KKIMLQSGVA
2460 2470 2480 2490 2500
TKSTVFLFSD NQIKHESFVE DINMLLNTGD VPNIFPADEK ADLVEKMQTA
2510 2520 2530 2540 2550
ARTEGEKVEA TPLSMYNFFI ERGTNRAYFS LAMSPIGDAF RTRLRMFPSL
2560 2570 2580 2590 2600
INCCTIDWFQ SWPTDALELV ANKFLEDVEL DDNIRAEVVS MCKYFQESVK
2610 2620 2630 2640 2650
KLSVDYYNTL LRHNYVTPTS YLELILTFKT LLNSKRQEVD TIRNRYLAGL
2660 2670 2680 2690 2700
QKLEFASSQV AVMQVELTAL QPQLIQTSED TAMMMVKIEL ETKEADAKKL
2710 2720 2730 2740 2750
LVQADEKEAN AAAAISQAIK NECEGDLAEA MPALEAALAA LDTLNPSDIT
2760 2770 2780 2790 2800
LVKSMQNPPG PVKLVMESIC VMKGLKPERK PDPSGSGKMI EDYWGVSRKI
2810 2820 2830 2840 2850
LGDLKFLESL KTYDKDNIPS VIMKRIRERF IDHPDFQPAV IKNVSSACEG
2860 2870 2880 2890 2900
LCKWVRAMEV YDRVAKVVAP KRERLREAEG KLEIQMQKLN QKRAELKLVE
2910 2920 2930 2940 2950
DRLQDLNDEF ELMNRKKNSL EKNIEICSQK LVRAEKLISG LGGEKDRWTE
2960 2970 2980 2990 3000
AARQLGIRYD NLTGDVLLAS GTVAYLGAFT VDYRAQCQNE WLVSCKDKVI
3010 3020 3030 3040 3050
PGSVDFSLSN TLGDPIKIRA WQIAGLPVDS FSVDNGIIVS NSRRWPLMID
3060 3070 3080 3090 3100
PQGQANKWVK NMEKTNKLSV IKFSDTNYVR TLENALQFGT PVLLENVGEE
3110 3120 3130 3140 3150
LDAFIEPILL KATFKQQGVE YMRLGENIIE YSREFKFYIT TRLRNPHYLP
3160 3170 3180 3190 3200
EVAVKVCLLN FMITPLGLQD QLLGIVAAKE KPELEEKKNK LILESAQNKK
3210 3220 3230 3240 3250
QLKEIEDKIL EVLSLCEGNI LEDETAIKIL SSSKVLSEEI SEKQEIASVT
3260 3270 3280 3290 3300
ETQIDETRMG YKPVAVHSAA IFFCISDLAH IEPMYQYSLT WFINLYVQSL
3310 3320 3330 3340 3350
ANSNKSDELD LRIEYIIEHF TLSIYNNVCR SLFEKDKLLF SLLLTVGLLK
3360 3370 3380 3390 3400
ERKAIDEEVW YFLLTGGVAL DNPFPNPAPE WLSEKSWGEI VRASSLQKLK
3410 3420 3430 3440 3450
GLMEDVMQNI KVWKDIYDSA WPHEESLPSP WFFLQTLEKI AILRCLRPDK
3460 3470 3480 3490 3500
IVPAIQNFIC ETMGKIFIEA PTFDLQGSYG DSSCCVPLIF ILSPGADPMA
3510 3520 3530 3540 3550
GLLKFADDVS MGGTKTQTIS LGQGQGPIAA NMINKAIHEG TWVVLQNCHL
3560 3570 3580 3590 3600
ATSWMPALEK ICEEVIVPEN TNSEFRLWLT SYPSEKFPVS ILQNGIKMTN
3610 3620 3630 3640 3650
EPPKGLRANL LRSYLNDPIS DPLFFQSCTK PVIWQKLLFG LCFFHAIVQE
3660 3670 3680 3690 3700
RRNYGALGWN IPYEFNESDL RISMRQIQMF LNDYEEVPFE ALTYLTGECN
3710 3720 3730 3740 3750
YGGRVTDDKD RRLLLSLLSM FYCKEIETDN YHIAPGDAYV IPPYGSYQSY
3760 3770 3780 3790 3800
IEYLRTLPIT AHPEVFGLHE NADITKDNQE TNQLFQGVLL TLPRQSGGSG
3810 3820 3830 3840 3850
KSPQEVVEEL AQDILSKLPN DFNLEEVMKK YPVVYKESMN TVLRQELIRF
3860 3870 3880 3890 3900
NRLTKVVRRS LIDLGRAIKG QVLMSSELEE VFNSMLVGKV PAMWAAKSYP
3910 3920 3930 3940 3950
SLKPLGGYVA DLLARLTFFQ EWIDKGPPVV FWISGFYFTQ SFLTGVSQNY
3960 3970 3980 3990 4000
ARKYTIPIDH IGFEFEVTPK ETTMENIPED GAYIKGLFLE GARWDRSTSQ
4010 4020 4030 4040 4050
IGESLPKILY DPLPIIWLKP GESASFLHQD IYVCPVYKTS ARRGILSTTG
4060 4070 4080
HSTNYVLSIE LPTDMPQKHW INRGVASLCQ LDN
Length:4,083
Mass (Da):467,777
Last modified:February 26, 2008 - v2
Checksum:i4E72F4B2EFF4A3CB
GO
Isoform 2 (identifier: Q8BW94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3921-3957: EWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIP → VPGNLGNWIPGSSLRWRRHCGVAEQKLGTRVGSCVAS
     3958-4083: Missing.

Note: No experimental confirmation available.
Show »
Length:3,957
Mass (Da):453,180
Checksum:iC4F90D4F9ABCA926
GO
Isoform 3 (identifier: Q8BW94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2523-2530: GTNRAYFS → VRKNLHIV
     2720-2737: KNECEGDLAEAMPALEAA → KVCDQARGAQGANTAKRM
     2738-4083: Missing.

Note: No experimental confirmation available.
Show »
Length:2,737
Mass (Da):314,915
Checksum:i6D36017370804A5B
GO

Sequence cautioni

The sequence BAC35298.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1506 – 15094AELP → SDLQ in CAB06070 (PubMed:9373155).Curated
Sequence conflicti1514 – 15141A → P in CAB06070 (PubMed:9373155).Curated
Sequence conflicti1520 – 15201A → P in CAB06070 (PubMed:9373155).Curated
Sequence conflicti1570 – 15712MR → IS in CAB06070 (PubMed:9373155).Curated
Sequence conflicti3182 – 31821P → T in BAC35298 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2523 – 25308GTNRAYFS → VRKNLHIV in isoform 3. 1 PublicationVSP_031926
Alternative sequencei2720 – 273718KNECE…ALEAA → KVCDQARGAQGANTAKRM in isoform 3. 1 PublicationVSP_031927Add
BLAST
Alternative sequencei2738 – 40831346Missing in isoform 3. 1 PublicationVSP_031928Add
BLAST
Alternative sequencei3921 – 395737EWIDK…KYTIP → VPGNLGNWIPGSSLRWRRHC GVAEQKLGTRVGSCVAS in isoform 2. 1 PublicationVSP_031929Add
BLAST
Alternative sequencei3958 – 4083126Missing in isoform 2. 1 PublicationVSP_031930Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC122853 Genomic DNA. No translation available.
AC131702 Genomic DNA. No translation available.
Z83816 mRNA. Translation: CAB06070.1.
BC051401 mRNA. Translation: AAH51401.1.
AK053178 mRNA. Translation: BAC35298.1. Different initiation.
UniGeneiMm.490012.

Genome annotation databases

EnsembliENSMUST00000046993; ENSMUSP00000042857; ENSMUSG00000052273. [Q8BW94-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC122853 Genomic DNA. No translation available.
AC131702 Genomic DNA. No translation available.
Z83816 mRNA. Translation: CAB06070.1.
BC051401 mRNA. Translation: AAH51401.1.
AK053178 mRNA. Translation: BAC35298.1. Different initiation.
UniGeneiMm.490012.

3D structure databases

ProteinModelPortaliQ8BW94.
SMRiQ8BW94. Positions 2678-2931, 3529-3736.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000042857.

PTM databases

PhosphoSiteiQ8BW94.

Proteomic databases

PaxDbiQ8BW94.
PRIDEiQ8BW94.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000046993; ENSMUSP00000042857; ENSMUSG00000052273. [Q8BW94-1]

Organism-specific databases

MGIiMGI:2683040. Dnah3.

Phylogenomic databases

eggNOGiKOG3595. Eukaryota.
COG5245. LUCA.
GeneTreeiENSGT00760000118964.
HOGENOMiHOG000237308.
HOVERGENiHBG107830.
InParanoidiQ8BW94.
OMAiKEKSTYP.
OrthoDBiEOG7BW0HH.
PhylomeDBiQ8BW94.
TreeFamiTF316836.

Miscellaneous databases

PROiQ8BW94.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BW94.
CleanExiMM_DNAHC3.

Family and domain databases

Gene3Di3.40.50.300. 5 hits.
InterProiIPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 2 hits.
PfamiPF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 5 hits.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  2. "Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene."
    Neesen J., Koehler M.R., Kirschner R., Steinlein C., Kreutzberger J., Engel W., Schmid M.
    Gene 200:193-202(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1381-1584 (ISOFORM 1).
    Strain: NMRI.
    Tissue: Testis.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2388-4083 (ISOFORM 3).
    Tissue: Olfactory epithelium.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2980-4083 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Lung.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Testis.

Entry informationi

Entry nameiDYH3_MOUSE
AccessioniPrimary (citable) accession number: Q8BW94
Secondary accession number(s): O08829, Q7TT83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: May 11, 2016
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.