Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein Pegasus

Gene

Ikzf5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

DNA-binding protein that binds to the 5'GNNTGTNG-3' core sequence. Transcriptional repressor (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri82 – 10423C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri110 – 13223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri138 – 16124C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri364 – 38623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri392 – 41625C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein Pegasus
Alternative name(s):
Ikaros family zinc finger protein 5
Gene namesi
Name:Ikzf5
Synonyms:Zfpn1a5, Znfn1a5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1914393. Ikzf5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 419419Zinc finger protein PegasusPRO_0000299472Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki5 – 5Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ8BU00.
PaxDbiQ8BU00.
PeptideAtlasiQ8BU00.
PRIDEiQ8BU00.

PTM databases

PhosphoSiteiQ8BU00.

Expressioni

Gene expression databases

BgeeiENSMUSG00000040167.
CleanExiMM_IKZF5.
ExpressionAtlasiQ8BU00. baseline and differential.
GenevisibleiQ8BU00. MM.

Interactioni

Subunit structurei

Self-associates. Interacts with other family members; IKZF1, IKZF2, IKZF3 AND IKZF4 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035583.

Structurei

3D structure databases

ProteinModelPortaliQ8BU00.
SMRiQ8BU00. Positions 84-164, 353-411.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The N-terminal zinc fingers are involved in sequence-specific DNA binding and heterotypic associations with other family members.By similarity
C-terminal zinc fingers mediate homodimerization.By similarity

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri82 – 10423C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri110 – 13223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri138 – 16124C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri364 – 38623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri392 – 41625C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00550000074392.
HOGENOMiHOG000095162.
HOVERGENiHBG108001.
InParanoidiQ8BU00.
KOiK09220.
OMAiELEYHRE.
OrthoDBiEOG091G07B0.
PhylomeDBiQ8BU00.
TreeFamiTF331860.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BU00-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEKKPEPLD FVKDFQEYLT QQTHHVNMIS GSVSGDKEAE TLQGAGTDGD
60 70 80 90 100
QNGLDHPSVE VSLDENSGML VDGFERTFDG KLKCRYCNYA SKGTARLIEH
110 120 130 140 150
IRIHTGEKPH RCHLCPFASA YERHLEAHMR SHTGEKPYKC ELCSFRCSDR
160 170 180 190 200
SNLSHHRRRK HKMVPIKGTR SSLSSKKMWG VLQKKTSNLG YSRRALINLS
210 220 230 240 250
PPSMVVQKPD YLNDFTHEIP NIQTDSYEAM AKTTPTGGLP RDPQELMVDN
260 270 280 290 300
PLNQLSTLAG QLSSLPPENQ NPASPDVDAC PDEKPFMIQQ PSAQAVVSAV
310 320 330 340 350
SASIPQSSSP TSPEPRPSHS QRNYSPVAGP SSEPSAHTST PSIGNSQPST
360 370 380 390 400
PAPTLPVQDP QLLHHCQHCD VYFADNVLYT VHMGCHGYDS PFQCNVCGCK
410
CKDKYDFACH FARGQHNQH
Length:419
Mass (Da):46,400
Last modified:March 1, 2003 - v1
Checksum:iBD153175F261D97B
GO
Isoform 2 (identifier: Q8BU00-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.
     68-103: GMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRI → MHFCKEFYFCISSHMQWTNMKSPMSELLLQSLPCLS

Show »
Length:352
Mass (Da):39,265
Checksum:iC64E32D48A945538
GO
Isoform 3 (identifier: Q8BU00-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-258: Missing.

Note: No experimental confirmation available.
Show »
Length:266
Mass (Da):28,904
Checksum:i0143B52A850334B6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti9 – 91L → W in BAE32231 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6767Missing in isoform 2. 1 PublicationVSP_027692Add
BLAST
Alternative sequencei68 – 10336GMLVD…EHIRI → MHFCKEFYFCISSHMQWTNM KSPMSELLLQSLPCLS in isoform 2. 1 PublicationVSP_027693Add
BLAST
Alternative sequencei106 – 258153Missing in isoform 3. 1 PublicationVSP_027694Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK033716 mRNA. Translation: BAC28443.1.
AK088289 mRNA. Translation: BAC40260.1.
AK140401 mRNA. Translation: BAE24372.1.
AK153883 mRNA. Translation: BAE32231.1.
AK169384 mRNA. Translation: BAE41131.1.
BC048183 mRNA. Translation: AAH48183.1.
BC058537 mRNA. Translation: AAH58537.1.
BC089455 mRNA. Translation: AAH89455.1.
CCDSiCCDS21915.1. [Q8BU00-1]
RefSeqiNP_780324.2. NM_175115.4. [Q8BU00-1]
XP_006508185.1. XM_006508122.2. [Q8BU00-1]
UniGeneiMm.334273.

Genome annotation databases

EnsembliENSMUST00000046306; ENSMUSP00000035583; ENSMUSG00000040167. [Q8BU00-1]
ENSMUST00000121033; ENSMUSP00000113714; ENSMUSG00000040167. [Q8BU00-3]
GeneIDi67143.
KEGGimmu:67143.
UCSCiuc009kbj.1. mouse. [Q8BU00-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK033716 mRNA. Translation: BAC28443.1.
AK088289 mRNA. Translation: BAC40260.1.
AK140401 mRNA. Translation: BAE24372.1.
AK153883 mRNA. Translation: BAE32231.1.
AK169384 mRNA. Translation: BAE41131.1.
BC048183 mRNA. Translation: AAH48183.1.
BC058537 mRNA. Translation: AAH58537.1.
BC089455 mRNA. Translation: AAH89455.1.
CCDSiCCDS21915.1. [Q8BU00-1]
RefSeqiNP_780324.2. NM_175115.4. [Q8BU00-1]
XP_006508185.1. XM_006508122.2. [Q8BU00-1]
UniGeneiMm.334273.

3D structure databases

ProteinModelPortaliQ8BU00.
SMRiQ8BU00. Positions 84-164, 353-411.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035583.

PTM databases

PhosphoSiteiQ8BU00.

Proteomic databases

MaxQBiQ8BU00.
PaxDbiQ8BU00.
PeptideAtlasiQ8BU00.
PRIDEiQ8BU00.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000046306; ENSMUSP00000035583; ENSMUSG00000040167. [Q8BU00-1]
ENSMUST00000121033; ENSMUSP00000113714; ENSMUSG00000040167. [Q8BU00-3]
GeneIDi67143.
KEGGimmu:67143.
UCSCiuc009kbj.1. mouse. [Q8BU00-1]

Organism-specific databases

CTDi64376.
MGIiMGI:1914393. Ikzf5.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00550000074392.
HOGENOMiHOG000095162.
HOVERGENiHBG108001.
InParanoidiQ8BU00.
KOiK09220.
OMAiELEYHRE.
OrthoDBiEOG091G07B0.
PhylomeDBiQ8BU00.
TreeFamiTF331860.

Miscellaneous databases

PROiQ8BU00.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040167.
CleanExiMM_IKZF5.
ExpressionAtlasiQ8BU00. baseline and differential.
GenevisibleiQ8BU00. MM.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIKZF5_MOUSE
AccessioniPrimary (citable) accession number: Q8BU00
Secondary accession number(s): Q3U549, Q3USG0, Q8BZR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

'Pegasus' was the winged horse in Greek mythology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.