Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cilia- and flagella-associated protein 20

Gene

Cfap20

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Cilia- and flagella-associated protein 20
Alternative name(s):
Gene trap locus 3 protein
Gene namesi
Name:Cfap20
Synonyms:Gtl3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:107428. Cfap20.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: UniProtKB
  • ciliary basal body Source: UniProtKB
  • cilium Source: MGI
  • extracellular exosome Source: MGI
  • microtubule Source: UniProtKB-KW
  • nucleoplasm Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 193193Cilia- and flagella-associated protein 20PRO_0000296399Add
BLAST

Proteomic databases

EPDiQ8BTU1.
MaxQBiQ8BTU1.
PaxDbiQ8BTU1.
PRIDEiQ8BTU1.

PTM databases

iPTMnetiQ8BTU1.
PhosphoSiteiQ8BTU1.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Developmental stagei

Widely expressed in midgestation embryos.1 Publication

Gene expression databases

BgeeiQ8BTU1.
CleanExiMM_GTL3.
GenevisibleiQ8BTU1. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034249.

Family & Domainsi

Sequence similaritiesi

Belongs to the CFAP20 family.Curated

Phylogenomic databases

eggNOGiKOG3213. Eukaryota.
ENOG410XS39. LUCA.
GeneTreeiENSGT00390000004554.
HOGENOMiHOG000257095.
HOVERGENiHBG102938.
InParanoidiQ8BTU1.
OMAiLRIQIHA.
OrthoDBiEOG7DNNX8.
PhylomeDBiQ8BTU1.
TreeFamiTF313405.

Family and domain databases

InterProiIPR007714. CFA20/WDR90/C3orf67.
[Graphical view]
PANTHERiPTHR12458. PTHR12458. 1 hit.
PfamiPF05018. DUF667. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BTU1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFKNTFQSGF LSILYSIGSK PLQIWDKKVR NGHIKRITDN DIQSLVLEIE
60 70 80 90 100
GTNVSTTYIT CPADPKKTLG IKLPFLVMII KNLKKYFTFE VQVLDDKNVR
110 120 130 140 150
RRFRASNYQS TTRVKPFICT MPMRLDDGWN QIQFNLSDFT RRAYGTNYIE
160 170 180 190
TLRVQIHANC RIRRVYFSDR LYSEDELPAE FKLYLPVQNK AKQ
Length:193
Mass (Da):22,748
Last modified:March 1, 2003 - v1
Checksum:i9DF3DB123A15BF77
GO
Isoform 2 (identifier: Q8BTU1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-193: IHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ → VLHLPHRESHTGGFRTLWLANWLAYGPWSRTM

Show »
Length:187
Mass (Da):21,927
Checksum:i7F67DAC785940104
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti72 – 721K → I in CAA90889 (PubMed:8688464).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei156 – 19338IHANC…NKAKQ → VLHLPHRESHTGGFRTLWLA NWLAYGPWSRTM in isoform 2. 1 PublicationVSP_027219Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z54179 mRNA. Translation: CAA90889.1.
AK088713 mRNA. Translation: BAC40521.1.
AK172603 mRNA. Translation: BAE43087.1.
BC119023 mRNA. Translation: AAI19024.1.
BC119025 mRNA. Translation: AAI19026.1.
CCDSiCCDS40445.1. [Q8BTU1-1]
RefSeqiNP_032213.2. NM_008187.2. [Q8BTU1-1]
UniGeneiMm.2080.

Genome annotation databases

EnsembliENSMUST00000034249; ENSMUSP00000034249; ENSMUSG00000031796. [Q8BTU1-1]
GeneIDi14894.
KEGGimmu:14894.
UCSCiuc009myi.2. mouse. [Q8BTU1-2]
uc009myj.2. mouse. [Q8BTU1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z54179 mRNA. Translation: CAA90889.1.
AK088713 mRNA. Translation: BAC40521.1.
AK172603 mRNA. Translation: BAE43087.1.
BC119023 mRNA. Translation: AAI19024.1.
BC119025 mRNA. Translation: AAI19026.1.
CCDSiCCDS40445.1. [Q8BTU1-1]
RefSeqiNP_032213.2. NM_008187.2. [Q8BTU1-1]
UniGeneiMm.2080.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034249.

PTM databases

iPTMnetiQ8BTU1.
PhosphoSiteiQ8BTU1.

Proteomic databases

EPDiQ8BTU1.
MaxQBiQ8BTU1.
PaxDbiQ8BTU1.
PRIDEiQ8BTU1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034249; ENSMUSP00000034249; ENSMUSG00000031796. [Q8BTU1-1]
GeneIDi14894.
KEGGimmu:14894.
UCSCiuc009myi.2. mouse. [Q8BTU1-2]
uc009myj.2. mouse. [Q8BTU1-1]

Organism-specific databases

CTDi29105.
MGIiMGI:107428. Cfap20.

Phylogenomic databases

eggNOGiKOG3213. Eukaryota.
ENOG410XS39. LUCA.
GeneTreeiENSGT00390000004554.
HOGENOMiHOG000257095.
HOVERGENiHBG102938.
InParanoidiQ8BTU1.
OMAiLRIQIHA.
OrthoDBiEOG7DNNX8.
PhylomeDBiQ8BTU1.
TreeFamiTF313405.

Miscellaneous databases

NextBioi287183.
PROiQ8BTU1.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BTU1.
CleanExiMM_GTL3.
GenevisibleiQ8BTU1. MM.

Family and domain databases

InterProiIPR007714. CFA20/WDR90/C3orf67.
[Graphical view]
PANTHERiPTHR12458. PTHR12458. 1 hit.
PfamiPF05018. DUF667. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and expression pattern of an evolutionarily conserved transcript identified by gene trapping."
    Ruether U., Rijkers T.
    Biochim. Biophys. Acta 1307:294-300(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: BALB/cJ.
    Tissue: Testis.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: NOD.
    Tissue: Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney, Lung, Spleen and Testis.

Entry informationi

Entry nameiCFA20_MOUSE
AccessioniPrimary (citable) accession number: Q8BTU1
Secondary accession number(s): P70212, Q3T9D6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: March 1, 2003
Last modified: March 16, 2016
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.