Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein NDRG4

Gene

Ndrg4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.1 Publication

GO - Biological processi

  • brain development Source: GO_Central
  • cell migration involved in heart development Source: BHF-UCL
  • negative regulation of platelet-derived growth factor receptor signaling pathway Source: MGI
  • negative regulation of smooth muscle cell migration Source: MGI
  • negative regulation of smooth muscle cell proliferation Source: MGI
  • positive regulation of ERK1 and ERK2 cascade Source: MGI
  • positive regulation of neuron projection development Source: Ensembl
  • regulation of endocytic recycling Source: BHF-UCL
  • signal transduction Source: GO_Central
  • vesicle docking Source: BHF-UCL
  • visual learning Source: BHF-UCL
Complete GO annotation...

Protein family/group databases

ESTHERimouse-ndr4. Ndr_family.
MEROPSiS33.986.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein NDRG4
Alternative name(s):
N-myc downstream-regulated gene 4 protein
Protein Ndr4
Gene namesi
Name:Ndrg4
Synonyms:Kiaa1180, Ndr4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2384590. Ndrg4.

Subcellular locationi

GO - Cellular componenti

  • basolateral plasma membrane Source: MGI
  • cell projection membrane Source: BHF-UCL
  • cytoplasm Source: BHF-UCL
  • cytosol Source: UniProtKB-SubCell
  • endoplasmic reticulum membrane Source: Ensembl
  • mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

Mutant mice have impaired spatial learning and memory but normal motor function.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 352352Protein NDRG4PRO_0000159580Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei298 – 2981PhosphoserineBy similarity
Modified residuei317 – 3171PhosphoserineBy similarity
Modified residuei323 – 3231PhosphoserineCombined sources
Isoform 2 (identifier: Q8BTG7-2)
Modified residuei293 – 2931PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8BTG7.
PaxDbiQ8BTG7.
PeptideAtlasiQ8BTG7.
PRIDEiQ8BTG7.

PTM databases

iPTMnetiQ8BTG7.
PhosphoSiteiQ8BTG7.

Expressioni

Tissue specificityi

Predominantly expressed in the brain (at protein level). Detected in neurons of various parts of brain, including the olfactory bulb, olfactory tuberculum, cerebral cortex, striatum, hippocampus, dentate gyrus, thalamus, hypothalamus, mesencephalon, cerebellum, pons and medulla oblongata.1 Publication

Gene expression databases

BgeeiQ8BTG7.
CleanExiMM_NDRG4.
ExpressionAtlasiQ8BTG7. baseline and differential.
GenevisibleiQ8BTG7. MM.

Interactioni

Protein-protein interaction databases

IntActiQ8BTG7. 1 interaction.
MINTiMINT-4387215.
STRINGi10090.ENSMUSP00000072883.

Structurei

3D structure databases

ProteinModelPortaliQ8BTG7.
SMRiQ8BTG7. Positions 9-290.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi253 – 2564Poly-Thr

Sequence similaritiesi

Belongs to the NDRG family.Curated

Phylogenomic databases

eggNOGiKOG2931. Eukaryota.
ENOG410XSPF. LUCA.
GeneTreeiENSGT00390000001874.
HOGENOMiHOG000230891.
HOVERGENiHBG052591.
InParanoidiQ8BTG7.
OMAiNTFFNYE.
PhylomeDBiQ8BTG7.
TreeFamiTF313168.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR004142. NDRG.
IPR030695. NDRG4.
[Graphical view]
PANTHERiPTHR11034. PTHR11034. 1 hit.
PTHR11034:SF21. PTHR11034:SF21. 1 hit.
PfamiPF03096. Ndr. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BTG7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF
60 70 80 90 100
FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV
110 120 130 140 150
QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLMNID PNGKGWIDWA
160 170 180 190 200
ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIS NVVNQANLQL
210 220 230 240 250
FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE EGVVECNSKL
260 270 280 290 300
DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA HLKDRRLSGG
310 320 330 340 350
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ PCAHSDSSEG MGQVNHTMEV

SC
Length:352
Mass (Da):38,509
Last modified:March 1, 2003 - v1
Checksum:i3ED388148DC852CD
GO
Isoform 2 (identifier: Q8BTG7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAHLKDRRLSGGAV → M

Show »
Length:339
Mass (Da):37,165
Checksum:i4FE9617B206700A2
GO
Isoform 3 (identifier: Q8BTG7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLQLLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATEMDNPDAFLSIVDTDWK

Show »
Length:404
Mass (Da):44,390
Checksum:i82668DC8A956EEDB
GO

Sequence cautioni

The sequence BAC98115.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 77MPECWDG → MKVLGHRLQLLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATEMDNPDAFLSIVDTDWK in isoform 3. 1 PublicationVSP_022958
Alternative sequencei289 – 30214IAHLK…SGGAV → M in isoform 2. 1 PublicationVSP_022959Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090374 mRNA. Translation: BAC41189.1.
AK168873 mRNA. Translation: BAE40691.1.
AK129305 mRNA. Translation: BAC98115.1. Different initiation.
BC006595 mRNA. Translation: AAH06595.1.
CCDSiCCDS22565.1. [Q8BTG7-2]
CCDS57634.1. [Q8BTG7-1]
RefSeqiNP_001181935.1. NM_001195006.1. [Q8BTG7-1]
NP_663577.1. NM_145602.3. [Q8BTG7-2]
XP_006530930.1. XM_006530867.1. [Q8BTG7-3]
UniGeneiMm.29846.

Genome annotation databases

EnsembliENSMUST00000041318; ENSMUSP00000036226; ENSMUSG00000036564. [Q8BTG7-3]
ENSMUST00000073139; ENSMUSP00000072883; ENSMUSG00000036564. [Q8BTG7-1]
ENSMUST00000080666; ENSMUSP00000079495; ENSMUSG00000036564. [Q8BTG7-2]
GeneIDi234593.
KEGGimmu:234593.
UCSCiuc009mys.2. mouse. [Q8BTG7-3]
uc009myt.2. mouse. [Q8BTG7-2]
uc009myu.2. mouse. [Q8BTG7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090374 mRNA. Translation: BAC41189.1.
AK168873 mRNA. Translation: BAE40691.1.
AK129305 mRNA. Translation: BAC98115.1. Different initiation.
BC006595 mRNA. Translation: AAH06595.1.
CCDSiCCDS22565.1. [Q8BTG7-2]
CCDS57634.1. [Q8BTG7-1]
RefSeqiNP_001181935.1. NM_001195006.1. [Q8BTG7-1]
NP_663577.1. NM_145602.3. [Q8BTG7-2]
XP_006530930.1. XM_006530867.1. [Q8BTG7-3]
UniGeneiMm.29846.

3D structure databases

ProteinModelPortaliQ8BTG7.
SMRiQ8BTG7. Positions 9-290.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BTG7. 1 interaction.
MINTiMINT-4387215.
STRINGi10090.ENSMUSP00000072883.

Protein family/group databases

ESTHERimouse-ndr4. Ndr_family.
MEROPSiS33.986.

PTM databases

iPTMnetiQ8BTG7.
PhosphoSiteiQ8BTG7.

Proteomic databases

MaxQBiQ8BTG7.
PaxDbiQ8BTG7.
PeptideAtlasiQ8BTG7.
PRIDEiQ8BTG7.

Protocols and materials databases

DNASUi234593.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041318; ENSMUSP00000036226; ENSMUSG00000036564. [Q8BTG7-3]
ENSMUST00000073139; ENSMUSP00000072883; ENSMUSG00000036564. [Q8BTG7-1]
ENSMUST00000080666; ENSMUSP00000079495; ENSMUSG00000036564. [Q8BTG7-2]
GeneIDi234593.
KEGGimmu:234593.
UCSCiuc009mys.2. mouse. [Q8BTG7-3]
uc009myt.2. mouse. [Q8BTG7-2]
uc009myu.2. mouse. [Q8BTG7-1]

Organism-specific databases

CTDi65009.
MGIiMGI:2384590. Ndrg4.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG2931. Eukaryota.
ENOG410XSPF. LUCA.
GeneTreeiENSGT00390000001874.
HOGENOMiHOG000230891.
HOVERGENiHBG052591.
InParanoidiQ8BTG7.
OMAiNTFFNYE.
PhylomeDBiQ8BTG7.
TreeFamiTF313168.

Miscellaneous databases

ChiTaRSiNdrg4. mouse.
PROiQ8BTG7.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BTG7.
CleanExiMM_NDRG4.
ExpressionAtlasiQ8BTG7. baseline and differential.
GenevisibleiQ8BTG7. MM.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR004142. NDRG.
IPR030695. NDRG4.
[Graphical view]
PANTHERiPTHR11034. PTHR11034. 1 hit.
PTHR11034:SF21. PTHR11034:SF21. 1 hit.
PfamiPF03096. Ndr. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Heart and Medulla oblongata.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary gland.
  4. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
    Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
    Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain cortex.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-323, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  6. "NDRG4 protein-deficient mice exhibit spatial learning deficits and vulnerabilities to cerebral ischemia."
    Yamamoto H., Kokame K., Okuda T., Nakajo Y., Yanamoto H., Miyata T.
    J. Biol. Chem. 286:26158-26165(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.

Entry informationi

Entry nameiNDRG4_MOUSE
AccessioniPrimary (citable) accession number: Q8BTG7
Secondary accession number(s): Q6ZPW3, Q923D7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: March 1, 2003
Last modified: July 6, 2016
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.