Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CCR4-NOT transcription complex subunit 4

Gene

Cnot4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has E3 ubiquitin ligase activity. Involved in activation of the JAK/STAT pathway (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri14 – 5744RING-type; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri190 – 21728C3H1-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Transcription, Transcription regulation, Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, RNA-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-6804115. TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 4 (EC:6.3.2.-)
Alternative name(s):
CCR4-associated factor 4
E3 ubiquitin-protein ligase CNOT4
Potential transcriptional repressor NOT4Hp
Gene namesi
Name:Cnot4
Synonyms:Not4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1859026. Cnot4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 575575CCR4-NOT transcription complex subunit 4PRO_0000081680Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei71 – 711PhosphoserineCombined sources
Modified residuei301 – 3011PhosphoserineBy similarity
Modified residuei324 – 3241PhosphoserineCombined sources
Modified residuei432 – 4321PhosphoserineBy similarity
Isoform 2 (identifier: Q8BT14-2)
Modified residuei296 – 2961PhosphothreonineCombined sources
Modified residuei298 – 2981PhosphoserineCombined sources
Modified residuei304 – 3041PhosphoserineCombined sources

Post-translational modificationi

Autoubiquitinated.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ8BT14.
PaxDbiQ8BT14.
PRIDEiQ8BT14.

PTM databases

iPTMnetiQ8BT14.
PhosphoSiteiQ8BT14.

Expressioni

Gene expression databases

BgeeiENSMUSG00000038784.
CleanExiMM_CNOT4.
ExpressionAtlasiQ8BT14. baseline and differential.
GenevisibleiQ8BT14. MM.

Interactioni

Subunit structurei

Interacts with CNOT1 via its C-terminus but does not stably associate with the CCR4-NOT complex. Binds E2 ubiquitin ligases via its RING domain. Interacts (via RING domain) with UBE2D2 (By similarity).By similarity

Protein-protein interaction databases

IntActiQ8BT14. 2 interactions.
STRINGi10090.ENSMUSP00000110645.

Structurei

Secondary structure

1
575
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi111 – 1166Combined sources
Turni118 – 1203Combined sources
Helixi123 – 1275Combined sources
Turni129 – 1357Combined sources
Beta strandi138 – 1447Combined sources
Beta strandi151 – 1533Combined sources
Beta strandi157 – 1659Combined sources
Helixi166 – 17611Combined sources
Beta strandi179 – 1813Combined sources
Beta strandi184 – 1907Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CPINMR-A101-198[»]
ProteinModelPortaliQ8BT14.
SMRiQ8BT14. Positions 1-78, 103-198.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8BT14.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini109 – 18981RRMPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili68 – 10437Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 C3H1-type zinc finger.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri14 – 5744RING-type; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri190 – 21728C3H1-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG2068. Eukaryota.
COG5175. LUCA.
GeneTreeiENSGT00390000000068.
HOGENOMiHOG000065696.
HOVERGENiHBG051043.
InParanoidiQ8BT14.
KOiK10643.
PhylomeDBiQ8BT14.
TreeFamiTF106134.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR003954. RRM_dom_euk.
IPR000571. Znf_CCCH.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00361. RRM_1. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
PS50103. ZF_C3H1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BT14-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRSPDAKED PVECPLCMEP LEIDDINFFP CTCGYQICRF CWHRIRTDEN
60 70 80 90 100
GLCPACRKPY PEDPAVYKPL SQEELQRIKN EKKQKQNERK QKISENRKHL
110 120 130 140 150
ASVRVVQKNL VFVVGLSQRL ADPEVLKRPE YFGKFGKIHK VVINNSTSYA
160 170 180 190 200
GSQGPSASAY VTYIRSEDAL RAIQCVNNVV VDGRTLKASL GTTKYCSYFL
210 220 230 240 250
KNMQCPKPDC MYLHELGDEA ASFTKEEMQA GKHQEYEQKL LQELYKLNPN
260 270 280 290 300
FLQLSTGSVD KNKNKVTPLQ RYDTPIDKPS DSLSIGNGDN SQQISNSDTP
310 320 330 340 350
SPPPGLSKSN PVIPISSSNH SARSPFEGAV TESQSLFSDN FRHPNPIPSG
360 370 380 390 400
LPPFPSSPQT PSDWPTAPEP QSLFTSETIP VSSSTDWQAA FGFGSSKQPE
410 420 430 440 450
DDLGFDPFDV TRKALADLIE KELSVQDQPS LSPTSLQNAS SHTTTAKGPG
460 470 480 490 500
SGFLHSAAPT NANSLNSTFS VLPQRFPQFQ QHRAVYNSFG FPGQAARYPW
510 520 530 540 550
MAFPRNSIMH LNHTANPTSN SNFLDLNLPP QHNTGLGGIP IAGEEEVKVS
560 570
TMPLSASSHS LQQGQQPTSL HTTVA
Length:575
Mass (Da):63,474
Last modified:April 13, 2004 - v2
Checksum:iE0B763C8262D03CA
GO
Isoform 2 (identifier: Q8BT14-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S

Show »
Length:572
Mass (Da):63,026
Checksum:i55D834DB87099436
GO
Isoform 3 (identifier: Q8BT14-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-575: GEEEVKVSTMPLSASSHSLQQGQQPTSLHTTVA → DNNSSVESLN...LLQSSTLDRH

Note: No experimental confirmation available.
Show »
Length:713
Mass (Da):78,264
Checksum:i49303EA33BFA7A55
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti167 – 1671E → Q in BAC25801 (PubMed:16141072).Curated
Sequence conflicti177 – 1771N → H in BAC25801 (PubMed:16141072).Curated
Sequence conflicti207 – 2071K → Q in BAC25801 (PubMed:16141072).Curated
Sequence conflicti417 – 4171D → Y in BAC27779 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei271 – 2744RYDT → S in isoform 2. 1 PublicationVSP_009930
Alternative sequencei543 – 57533GEEEV…HTTVA → DNNSSVESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSVSWDS PGSWTDPAIITGIPASSGNT LDSIQDDNPPHWLKSLQALT EMDGPSAASSQPHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPGFQTAFRPPSKTPT DLLQSSTLDRH in isoform 3. 1 PublicationVSP_009931Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U71269 mRNA. Translation: AAD00181.1.
AK009234 mRNA. Translation: BAB26155.1.
AK028190 mRNA. Translation: BAC25801.1.
AK032248 mRNA. Translation: BAC27779.1.
BC058778 mRNA. Translation: AAH58778.1.
CCDSiCCDS19999.1. [Q8BT14-1]
CCDS80520.1. [Q8BT14-2]
RefSeqiNP_001157883.1. NM_001164411.1. [Q8BT14-2]
NP_001157885.1. NM_001164413.1.
NP_058573.3. NM_016877.4. [Q8BT14-1]
XP_011239709.1. XM_011241407.1. [Q8BT14-3]
XP_011239710.1. XM_011241408.1. [Q8BT14-3]
UniGeneiMm.214525.
Mm.398182.

Genome annotation databases

EnsembliENSMUST00000044163; ENSMUSP00000044137; ENSMUSG00000038784. [Q8BT14-1]
ENSMUST00000202417; ENSMUSP00000144409; ENSMUSG00000038784. [Q8BT14-2]
GeneIDi53621.
KEGGimmu:53621.
UCSCiuc009bid.2. mouse. [Q8BT14-3]
uc009big.2. mouse. [Q8BT14-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U71269 mRNA. Translation: AAD00181.1.
AK009234 mRNA. Translation: BAB26155.1.
AK028190 mRNA. Translation: BAC25801.1.
AK032248 mRNA. Translation: BAC27779.1.
BC058778 mRNA. Translation: AAH58778.1.
CCDSiCCDS19999.1. [Q8BT14-1]
CCDS80520.1. [Q8BT14-2]
RefSeqiNP_001157883.1. NM_001164411.1. [Q8BT14-2]
NP_001157885.1. NM_001164413.1.
NP_058573.3. NM_016877.4. [Q8BT14-1]
XP_011239709.1. XM_011241407.1. [Q8BT14-3]
XP_011239710.1. XM_011241408.1. [Q8BT14-3]
UniGeneiMm.214525.
Mm.398182.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CPINMR-A101-198[»]
ProteinModelPortaliQ8BT14.
SMRiQ8BT14. Positions 1-78, 103-198.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BT14. 2 interactions.
STRINGi10090.ENSMUSP00000110645.

PTM databases

iPTMnetiQ8BT14.
PhosphoSiteiQ8BT14.

Proteomic databases

MaxQBiQ8BT14.
PaxDbiQ8BT14.
PRIDEiQ8BT14.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000044163; ENSMUSP00000044137; ENSMUSG00000038784. [Q8BT14-1]
ENSMUST00000202417; ENSMUSP00000144409; ENSMUSG00000038784. [Q8BT14-2]
GeneIDi53621.
KEGGimmu:53621.
UCSCiuc009bid.2. mouse. [Q8BT14-3]
uc009big.2. mouse. [Q8BT14-1]

Organism-specific databases

CTDi4850.
MGIiMGI:1859026. Cnot4.

Phylogenomic databases

eggNOGiKOG2068. Eukaryota.
COG5175. LUCA.
GeneTreeiENSGT00390000000068.
HOGENOMiHOG000065696.
HOVERGENiHBG051043.
InParanoidiQ8BT14.
KOiK10643.
PhylomeDBiQ8BT14.
TreeFamiTF106134.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-MMU-6804115. TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain.

Miscellaneous databases

EvolutionaryTraceiQ8BT14.
PROiQ8BT14.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038784.
CleanExiMM_CNOT4.
ExpressionAtlasiQ8BT14. baseline and differential.
GenevisibleiQ8BT14. MM.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR003954. RRM_dom_euk.
IPR000571. Znf_CCCH.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00361. RRM_1. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
PS50103. ZF_C3H1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCNOT4_MOUSE
AccessioniPrimary (citable) accession number: Q8BT14
Secondary accession number(s): Q8CCR4, Q9CV74, Q9Z1D0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: September 7, 2016
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.