Q8BSP2 (CNDH2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Condensin-2 complex subunit H2 Alternative name(s): Kleisin-beta Non-SMC condensin II complex subunit H2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 607 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture By similarity. Seems to have lineage-specific role in T-cell development By similarity. |
| Subunit structure | Component of the condensin-2 complex, which contains the SMC2 and SMC4 heterodimer, and three non SMC subunits, NCAPG2, NCAPH2 and NCAPD3 that probably regulate the complex By similarity. |
| Subcellular location | Nucleus By similarity. |
| Involvement in disease | Defects in Ncaph2 are the cause of the nessy phenotype which is characterized by a specific defect in T-cell development. Nessy thymuses are smaller, with corticomedullary junctions less well defined, and cortical cells sparser than in wild-type. The thymocyte defect is typified by an increased proportion of CD4-CD8- DN T-cell progenitors. Only thymocyte differentiation is affected in Nessy mice and not cell differentiation. |
| Sequence similarities | Belongs to the CND2 H2 (condensin-2 subunit 2) family. |
| Sequence caution | The sequence AAH03900.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA condensation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | T cell differentiation in thymus Inferred from mutant phenotype Ref.3. Source: MGI chromosome condensationInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8BSP2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8BSP2-2) The sequence of this isoform differs from the canonical sequence as follows: 434-434: A → AA | ||||||
| Isoform 3 (identifier: Q8BSP2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MEDVEVRFAHLLQPIRDLTKNWEVDVAAQLGEYLEE → MWRCALLTSCSPSGISLRTGRWTWRHSW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 607 | 607 | Condensin-2 complex subunit H2 | PRO_0000326242 | |||||
Amino acid modifications | |||||||||
| Modified residue | 19 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 95 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 494 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MEDVE…EYLEE → MWRCALLTSCSPSGISLRTG RWTWRHSW in isoform 3. | VSP_032641 | |||||
| Alternative sequence | 434 | 1 | A → AA in isoform 2. | VSP_032642 | |||||
| Natural variant | 15 | 1 | I → N in Nessy. Ref.3 | ||||||
Experimental info | |||||||||
| Sequence conflict | 83 | 1 | D → N in BAC39479. Ref.1 | ||||||
| Sequence conflict | 208 | 1 | V → M in BAC29736. Ref.1 | ||||||
| Sequence conflict | 218 | 1 | K → E in BAC37919. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK004160 mRNA. Translation: BAB23198.1. AK031135 mRNA. Translation: BAC27270.1. AK037175 mRNA. Translation: BAC29736.1. AK080447 mRNA. Translation: BAC37919.1. AK085584 mRNA. Translation: BAC39479.1. AK088294 mRNA. Translation: BAC40265.1. AK146642 mRNA. Translation: BAE27325.1. AK152158 mRNA. Translation: BAE30993.1. AK163958 mRNA. Translation: BAE37553.1. AK165250 mRNA. Translation: BAE38104.1. BC003900 mRNA. Translation: AAH03900.1. Different initiation. |
| IPI | IPI00403116. IPI00625515. IPI00856653. |
| RefSeq | NP_001108604.1. NM_001115132.2. NP_001258530.1. NM_001271601.1. |
| UniGene | Mm.143167. |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8BSP2. |
Proteomic databases | |
| PaxDb | Q8BSP2. |
| PRIDE | Q8BSP2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000074552; ENSMUSP00000074139; ENSMUSG00000008690. ENSMUST00000088717; ENSMUSP00000086095; ENSMUSG00000008690. |
| GeneID | 52683. |
| KEGG | mmu:52683. |
| UCSC | uc007xgg.2. mouse. uc007xgh.2. mouse. uc007xgk.2. mouse. |
Organism-specific databases | |
| CTD | 29781. |
| MGI | MGI:1289164. Ncaph2. |
Phylogenomic databases | |
| eggNOG | NOG238357. |
| GeneTree | ENSGT00390000014443. |
| HOVERGEN | HBG098083. |
| KO | K11490. |
| OMA | EVSVCRS. |
| OrthoDB | EOG408N7P. |
Gene expression databases | |
| ArrayExpress | Q8BSP2. |
| Bgee | Q8BSP2. |
| CleanEx | MM_NCAPH2. |
| Genevestigator | Q8BSP2. |
Family and domain databases | |
| InterPro | IPR009378. Condensin_II_H2-like. [Graphical view] |
| Pfam | PF06278. DUF1032. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NCAPH2. mouse. |
| NextBio | 309335. |
| SOURCE | Search... |
Entry information
| Entry name | CNDH2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8BSP2 Secondary accession number(s): Q3TNI4 Q9CT99 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
