Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein bicaudal D homolog 1

Gene

Bicd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.By similarity

GO - Molecular functioni

GO - Biological processi

  • microtubule anchoring at microtubule organizing center Source: BHF-UCL
  • minus-end-directed organelle transport along microtubule Source: MGI
  • negative regulation of phospholipase C-activating G-protein coupled receptor signaling pathway Source: BHF-UCL
  • negative regulation of phospholipase C activity Source: BHF-UCL
  • positive regulation of receptor-mediated endocytosis Source: MGI
  • protein localization to organelle Source: MGI
  • regulation of proteinase activated receptor activity Source: BHF-UCL
  • stress granule assembly Source: BHF-UCL
  • viral process Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal D homolog 1
Short name:
Bic-D 1
Gene namesi
Name:Bicd1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1101760. Bicd1.

Subcellular locationi

  • Golgi apparatus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 835835Protein bicaudal D homolog 1PRO_0000205358Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 4 (identifier: Q8BR07-4)
Modified residuei865 – 8651Phosphoserine By similarityBy similarity

Post-translational modificationi

Isoform 4 is phosphorylated on Ser-865.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8BR07.
MaxQBiQ8BR07.
PaxDbiQ8BR07.
PRIDEiQ8BR07.

PTM databases

iPTMnetiQ8BR07.
PhosphoSiteiQ8BR07.

Expressioni

Tissue specificityi

Expressed in the brain, heart and skeletal muscle.

Developmental stagei

Expressed during embryonic development.

Gene expression databases

BgeeiQ8BR07.
CleanExiMM_BICD1.
ExpressionAtlasiQ8BR07. baseline and differential.
GenevisibleiQ8BR07. MM.

Interactioni

Subunit structurei

Interacts with RAB6A. Interacts (via C-terminus) with RAB6B (GTP-bound); the interaction is direct (By similarity). Interacts with CLIP-115 and KIFC2.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ8BR07. 1 interaction.
STRINGi10090.ENSMUSP00000084039.

Structurei

Secondary structure

1
835
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi711 – 73828Combined sources
Helixi741 – 80262Combined sources
Helixi804 – 8074Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4YTDX-ray1.50A/B711-808[»]
ProteinModelPortaliQ8BR07.
SMRiQ8BR07. Positions 711-808.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni663 – 803141Interacts with RAB6ABy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1 – 264264Sequence analysisAdd
BLAST
Coiled coili320 – 519200Sequence analysisAdd
BLAST
Coiled coili663 – 803141Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0999. Eukaryota.
ENOG410XR47. LUCA.
GeneTreeiENSGT00390000004114.
HOVERGENiHBG050686.
InParanoidiQ8BR07.
KOiK18739.
OrthoDBiEOG7BZVRK.
TreeFamiTF323833.

Family and domain databases

InterProiIPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view]
PANTHERiPTHR31233. PTHR31233. 2 hits.
PfamiPF09730. BicD. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BR07-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAEEALKTV DQYKTEIERL TKELTETTHE KIQAAEYGLV VLEEKLTLKQ
60 70 80 90 100
QYDELEAEYD GLKQELEQLR EAFGQSFSIH RKVAEDGETR EETLLQESAS
110 120 130 140 150
KEAYYLNKIL EMQNELKQSR AVVTNVQAEN ERLSAVVQEL KENNEMVELQ
160 170 180 190 200
RIRMKDEIRE YKFREARLLQ DYTELEEENI TLQKLVSTLK QNQVEYEGLK
210 220 230 240 250
HEIKRFEEET VLLNSQLEDA IRLKEIAEHQ LEEALETLKN EREQKNNLRK
260 270 280 290 300
ELSQYINLSD SHISISVDGL KFAEDGSEPN NDDKMNGHIH GPLGKLNGDY
310 320 330 340 350
RTPTTRKGES LHPVSDLFSE LNISEIQKLK QQLIQVEREK AILLANLQES
360 370 380 390 400
QTQLEHTKGA LTEQHERVHR LTEHVNAMRG LQNSKEIKAE LDCEKGRNSA
410 420 430 440 450
EEAHDYEVDI NGLEILECKY RVAVTEVIDL KAEIKALKEK YNKSVENYTE
460 470 480 490 500
EKTKYESKIQ MYDEQVTNLE KTSKESGEKM AHMEKELQKM TGIANENHNT
510 520 530 540 550
LNTAQDELVT FSEELAQLYH HVCLCNNETP NRVMLDYYRQ SRVTRSGSLK
560 570 580 590 600
GPDDPRGLLS PRLSRRGVSS PVESRTSSEP VSKENTETSK EPSPTKTPTI
610 620 630 640 650
SPVITAPPSS PVLDTSDIRK EPMNIYNLNA IIRDQIKHLQ KAVDRSLQLS
660 670 680 690 700
RQRAAARELA PMIDKDKEAL MEEILKLKSL LSTKREQIAT LRAVLKANKQ
710 720 730 740 750
TAEVALANLK NKYENEKAMV TETMTKLRNE LKALKEDAAT FSSLRAMFAT
760 770 780 790 800
RCDEYVTQLD EMQRQLAAAE DEKKTLNTLL RMAIQQKLAL TQRLEDLEFD
810 820 830
HEQSRRSKGK LGKSKIGSPK IVSSLLPPYR HSAHN
Length:835
Mass (Da):95,896
Last modified:August 15, 2003 - v2
Checksum:i33E8D83C56077C40
GO
Isoform 2 (identifier: Q8BR07-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-210: EYEGLKHEIKRFEEET → RLKIFKKLYHRWIHMF
     211-835: Missing.

Note: Due to intron retention.
Show »
Length:210
Mass (Da):25,048
Checksum:i7421A683F2F4EF00
GO
Isoform 3 (identifier: Q8BR07-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     821-835: IVSSLLPPYRHSAHN → SGHCPQ

Note: No experimental confirmation available.
Show »
Length:826
Mass (Da):94,833
Checksum:i46DEDA7C1DF5E542
GO
Isoform 4 (identifier: Q8BR07-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     821-835: IVSSLLPPYRHSAHN → VSGEAPDTVPTIDTYLLHSQGPQIPTIRVSSGTQRKRYACSYCHSVVQCTGFS

Note: Due to intron retention.By similarity
Show »
Length:873
Mass (Da):99,949
Checksum:i8151D3939E13B329
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 701R → K in CAC81709 (Ref. 4) Curated
Sequence conflicti86 – 861D → N in BAC34733 (PubMed:16141072).Curated
Sequence conflicti90 – 901R → Q in BAC38518 (PubMed:16141072).Curated
Sequence conflicti111 – 1111E → K in BAC30057 (PubMed:16141072).Curated
Sequence conflicti312 – 3121H → D in BAC32557 (PubMed:16141072).Curated
Sequence conflicti470 – 4701E → K in AAB94807 (PubMed:9367685).Curated
Sequence conflicti632 – 6321I → V in BAC32557 (PubMed:16141072).Curated
Sequence conflicti796 – 7961D → G in CAC81711 (Ref. 4) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei195 – 21016EYEGL…FEEET → RLKIFKKLYHRWIHMF in isoform 2. 1 PublicationVSP_007965Add
BLAST
Alternative sequencei211 – 835625Missing in isoform 2. 1 PublicationVSP_007966Add
BLAST
Alternative sequencei821 – 83515IVSSL…HSAHN → SGHCPQ in isoform 3. CuratedVSP_007967Add
BLAST
Alternative sequencei821 – 83515IVSSL…HSAHN → VSGEAPDTVPTIDTYLLHSQ GPQIPTIRVSSGTQRKRYAC SYCHSVVQCTGFS in isoform 4. CuratedVSP_007968Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK038585 mRNA. Translation: BAC30057.1.
AK043650 mRNA. Translation: BAC31607.1.
AK045975 mRNA. Translation: BAC32557.1.
AK051718 mRNA. Translation: BAC34733.1.
AK082523 mRNA. Translation: BAC38518.1.
BC016192 mRNA. Translation: AAH16192.1.
U90029 mRNA. Translation: AAB94807.1.
AJ288054 mRNA. Translation: CAC81709.1.
AJ288055 mRNA. Translation: CAC81710.1.
AJ288056 mRNA. Translation: CAC81711.1.
CCDSiCCDS39723.1. [Q8BR07-1]
CCDS51962.1. [Q8BR07-3]
RefSeqiNP_001106267.1. NM_001112796.2. [Q8BR07-3]
NP_033883.2. NM_009753.4. [Q8BR07-1]
UniGeneiMm.177181.
Mm.260763.

Genome annotation databases

EnsembliENSMUST00000086829; ENSMUSP00000084039; ENSMUSG00000003452. [Q8BR07-1]
ENSMUST00000111513; ENSMUSP00000107138; ENSMUSG00000003452. [Q8BR07-3]
GeneIDi12121.
KEGGimmu:12121.
UCSCiuc009eug.3. mouse. [Q8BR07-2]
uc009euh.3. mouse. [Q8BR07-1]
uc009eui.3. mouse. [Q8BR07-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK038585 mRNA. Translation: BAC30057.1.
AK043650 mRNA. Translation: BAC31607.1.
AK045975 mRNA. Translation: BAC32557.1.
AK051718 mRNA. Translation: BAC34733.1.
AK082523 mRNA. Translation: BAC38518.1.
BC016192 mRNA. Translation: AAH16192.1.
U90029 mRNA. Translation: AAB94807.1.
AJ288054 mRNA. Translation: CAC81709.1.
AJ288055 mRNA. Translation: CAC81710.1.
AJ288056 mRNA. Translation: CAC81711.1.
CCDSiCCDS39723.1. [Q8BR07-1]
CCDS51962.1. [Q8BR07-3]
RefSeqiNP_001106267.1. NM_001112796.2. [Q8BR07-3]
NP_033883.2. NM_009753.4. [Q8BR07-1]
UniGeneiMm.177181.
Mm.260763.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4YTDX-ray1.50A/B711-808[»]
ProteinModelPortaliQ8BR07.
SMRiQ8BR07. Positions 711-808.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BR07. 1 interaction.
STRINGi10090.ENSMUSP00000084039.

PTM databases

iPTMnetiQ8BR07.
PhosphoSiteiQ8BR07.

Proteomic databases

EPDiQ8BR07.
MaxQBiQ8BR07.
PaxDbiQ8BR07.
PRIDEiQ8BR07.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000086829; ENSMUSP00000084039; ENSMUSG00000003452. [Q8BR07-1]
ENSMUST00000111513; ENSMUSP00000107138; ENSMUSG00000003452. [Q8BR07-3]
GeneIDi12121.
KEGGimmu:12121.
UCSCiuc009eug.3. mouse. [Q8BR07-2]
uc009euh.3. mouse. [Q8BR07-1]
uc009eui.3. mouse. [Q8BR07-3]

Organism-specific databases

CTDi636.
MGIiMGI:1101760. Bicd1.

Phylogenomic databases

eggNOGiKOG0999. Eukaryota.
ENOG410XR47. LUCA.
GeneTreeiENSGT00390000004114.
HOVERGENiHBG050686.
InParanoidiQ8BR07.
KOiK18739.
OrthoDBiEOG7BZVRK.
TreeFamiTF323833.

Miscellaneous databases

NextBioi280435.
PROiQ8BR07.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BR07.
CleanExiMM_BICD1.
ExpressionAtlasiQ8BR07. baseline and differential.
GenevisibleiQ8BR07. MM.

Family and domain databases

InterProiIPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view]
PANTHERiPTHR31233. PTHR31233. 2 hits.
PfamiPF09730. BicD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Brain, Brain cortex, Cerebellum, Hypothalamus and Spinal ganglion.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary tumor.
  3. "A human homologue (BICD1) of the Drosophila bicaudal-D gene."
    Baens M., Marynen P.
    Genomics 45:601-606(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 231-775 (ISOFORM 1).
  4. "Mammalian BicD is a Golgi-associated protein that transiently interacts with the neuronal proteins CLIP-115 and KIFC2."
    Hoogenraad C.C., Akhmanova A., Galjart N.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), INTERACTION WITH CLIP-115 AND KIFC2, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiBICD1_MOUSE
AccessioniPrimary (citable) accession number: Q8BR07
Secondary accession number(s): O55206
, Q8BQ18, Q8BRR8, Q8C4D3, Q8CAK6, Q8R2J4, Q8R2J5, Q8R2J6, Q91YP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: August 15, 2003
Last modified: April 13, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.