Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8BQZ5

- CPSF4_MOUSE

UniProt

Q8BQZ5 - CPSF4_MOUSE

Protein

Cleavage and polyadenylation specificity factor subunit 4

Gene

Cpsf4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U) By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri35 – 6127C3H1-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri62 – 8928C3H1-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri111 – 13727C3H1-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri185 – 20218CCHC-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. RNA binding Source: UniProtKB-KW
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. mRNA processing Source: UniProtKB-KW

    Keywords - Biological processi

    mRNA processing

    Keywords - Ligandi

    Metal-binding, RNA-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cleavage and polyadenylation specificity factor subunit 4
    Alternative name(s):
    Cleavage and polyadenylation specificity factor 30 kDa subunit
    Short name:
    CPSF 30 kDa subunit
    Clipper homolog
    Clipper/CPSF 30K
    Gene namesi
    Name:Cpsf4
    Synonyms:Cpsf30
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:1861602. Cpsf4.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. mitochondrion Source: Ensembl
    2. mRNA cleavage and polyadenylation specificity factor complex Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 211211Cleavage and polyadenylation specificity factor subunit 4PRO_0000074403Add
    BLAST

    Proteomic databases

    MaxQBiQ8BQZ5.
    PaxDbiQ8BQZ5.
    PRIDEiQ8BQZ5.

    PTM databases

    PhosphoSiteiQ8BQZ5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8BQZ5.
    BgeeiQ8BQZ5.
    CleanExiMM_CPSF4.
    GenevestigatoriQ8BQZ5.

    Interactioni

    Subunit structurei

    Component of the cleavage and polyadenylation specificity factor (CPSF) complex, composed of CPSF1, CPSF2, CPSF3, CPSF4 and FIP1L1. Interacts with FIP1L1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi207591. 1 interaction.
    MINTiMINT-89829.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8BQZ5.
    SMRiQ8BQZ5. Positions 61-103.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CPSF4/YTH1 family.Curated
    Contains 3 C3H1-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 CCHC-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri35 – 6127C3H1-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri62 – 8928C3H1-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri111 – 13727C3H1-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri185 – 20218CCHC-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5084.
    GeneTreeiENSGT00390000009627.
    HOGENOMiHOG000212457.
    HOVERGENiHBG051108.
    KOiK14404.
    PhylomeDBiQ8BQZ5.
    TreeFamiTF314871.

    Family and domain databases

    Gene3Di4.10.1000.10. 2 hits.
    4.10.60.10. 1 hit.
    InterProiIPR000571. Znf_CCCH.
    IPR001878. Znf_CCHC.
    [Graphical view]
    PfamiPF00642. zf-CCCH. 2 hits.
    PF00098. zf-CCHC. 1 hit.
    [Graphical view]
    SMARTiSM00343. ZnF_C2HC. 1 hit.
    SM00356. ZnF_C3H1. 4 hits.
    [Graphical view]
    SUPFAMiSSF57756. SSF57756. 1 hit.
    PROSITEiPS50103. ZF_C3H1. 3 hits.
    PS50158. ZF_CCHC. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8BQZ5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQEIIASVDH IKFDLEIAVE QQLGAQPLPF PGMDKSGAAV CEFFLKAACG    50
    KGGMCPFRHI SGEKTVVCKH WLRGLCKKGD QCEFLHEYDM TKMPECYFYS 100
    KFGPLCRHRH TRRVICVNYL VGFCPEGPSC KFMHPRFELP MGTTEQPPLP 150
    QQTQPPTKRA PQVIGVMQSQ NSSAGNRGPR PLEQVTCYKC GEKGHYANRC 200
    TKGHLAFLSG Q 211

    Note: No experimental confirmation available.

    Length:211
    Mass (Da):23,653
    Last modified:March 1, 2003 - v1
    Checksum:iF5656741519E0E26
    GO
    Isoform 2 (identifier: Q8BQZ5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         103-103: G → GECSNKECPFLHIDPESKIKDCPWYDRGFCKHG
         158-158: K → KQ
         174-188: AGNRGPRPLEQVTCY → DSSSSSSSWNHCGAA
         189-211: Missing.

    Show »
    Length:221
    Mass (Da):24,881
    Checksum:i5DE80D92089DDC85
    GO
    Isoform 3 (identifier: Q8BQZ5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         103-103: G → GECSNKECPFLHIDPESKIKDCPWYDRGFCKHG
         159-180: RAPQVIGVMQSQNSSAGNRGPR → VLYPAASLATLACRDGLITHSV
         181-211: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:212
    Mass (Da):23,958
    Checksum:i75487F4FF13C64FB
    GO

    Sequence cautioni

    The sequence AAC53567.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAH57067.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei103 – 1031G → GECSNKECPFLHIDPESKIK DCPWYDRGFCKHG in isoform 2 and isoform 3. 2 PublicationsVSP_008603
    Alternative sequencei158 – 1581K → KQ in isoform 2. 1 PublicationVSP_008604
    Alternative sequencei159 – 18022RAPQV…NRGPR → VLYPAASLATLACRDGLITH SV in isoform 3. 1 PublicationVSP_008605Add
    BLAST
    Alternative sequencei174 – 18815AGNRG…QVTCY → DSSSSSSSWNHCGAA in isoform 2. 1 PublicationVSP_008606Add
    BLAST
    Alternative sequencei181 – 21131Missing in isoform 3. 1 PublicationVSP_008607Add
    BLAST
    Alternative sequencei189 – 21123Missing in isoform 2. 1 PublicationVSP_008608Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK046064 mRNA. Translation: BAC32587.1.
    AF033201 mRNA. Translation: AAC53567.1. Different initiation.
    BC057067 mRNA. Translation: AAH57067.1. Different initiation.
    CCDSiCCDS19859.1. [Q8BQZ5-1]
    RefSeqiNP_001278177.1. NM_001291248.1.
    NP_001278178.1. NM_001291249.1.
    NP_848671.1. NM_178576.3. [Q8BQZ5-1]
    UniGeneiMm.196884.

    Genome annotation databases

    EnsembliENSMUST00000070487; ENSMUSP00000069243; ENSMUSG00000029625. [Q8BQZ5-1]
    GeneIDi54188.
    KEGGimmu:54188.
    UCSCiuc009amj.1. mouse. [Q8BQZ5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK046064 mRNA. Translation: BAC32587.1 .
    AF033201 mRNA. Translation: AAC53567.1 . Different initiation.
    BC057067 mRNA. Translation: AAH57067.1 . Different initiation.
    CCDSi CCDS19859.1. [Q8BQZ5-1 ]
    RefSeqi NP_001278177.1. NM_001291248.1.
    NP_001278178.1. NM_001291249.1.
    NP_848671.1. NM_178576.3. [Q8BQZ5-1 ]
    UniGenei Mm.196884.

    3D structure databases

    ProteinModelPortali Q8BQZ5.
    SMRi Q8BQZ5. Positions 61-103.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 207591. 1 interaction.
    MINTi MINT-89829.

    PTM databases

    PhosphoSitei Q8BQZ5.

    Proteomic databases

    MaxQBi Q8BQZ5.
    PaxDbi Q8BQZ5.
    PRIDEi Q8BQZ5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000070487 ; ENSMUSP00000069243 ; ENSMUSG00000029625 . [Q8BQZ5-1 ]
    GeneIDi 54188.
    KEGGi mmu:54188.
    UCSCi uc009amj.1. mouse. [Q8BQZ5-1 ]

    Organism-specific databases

    CTDi 10898.
    MGIi MGI:1861602. Cpsf4.

    Phylogenomic databases

    eggNOGi COG5084.
    GeneTreei ENSGT00390000009627.
    HOGENOMi HOG000212457.
    HOVERGENi HBG051108.
    KOi K14404.
    PhylomeDBi Q8BQZ5.
    TreeFami TF314871.

    Miscellaneous databases

    ChiTaRSi CPSF4. mouse.
    NextBioi 311022.
    PROi Q8BQZ5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8BQZ5.
    Bgeei Q8BQZ5.
    CleanExi MM_CPSF4.
    Genevestigatori Q8BQZ5.

    Family and domain databases

    Gene3Di 4.10.1000.10. 2 hits.
    4.10.60.10. 1 hit.
    InterProi IPR000571. Znf_CCCH.
    IPR001878. Znf_CCHC.
    [Graphical view ]
    Pfami PF00642. zf-CCCH. 2 hits.
    PF00098. zf-CCHC. 1 hit.
    [Graphical view ]
    SMARTi SM00343. ZnF_C2HC. 1 hit.
    SM00356. ZnF_C3H1. 4 hits.
    [Graphical view ]
    SUPFAMi SSF57756. SSF57756. 1 hit.
    PROSITEi PS50103. ZF_C3H1. 3 hits.
    PS50158. ZF_CCHC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Corpora quadrigemina.
    2. "Drosophila clipper/CPSF 30K is a post-transcriptionally regulated nuclear protein that binds RNA containing GC clusters."
      Bai C., Tolias P.P.
      Nucleic Acids Res. 26:1597-1604(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-211 (ISOFORM 2), FUNCTION.
      Strain: C57BL/6J.
      Tissue: Embryo.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 45-211 (ISOFORM 3).
      Strain: C57BL/6.
      Tissue: Brain.

    Entry informationi

    Entry nameiCPSF4_MOUSE
    AccessioniPrimary (citable) accession number: Q8BQZ5
    Secondary accession number(s): O54930
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 24, 2003
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 90 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3