SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8BQZ5

- CPSF4_MOUSE

UniProt

Q8BQZ5 - CPSF4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cleavage and polyadenylation specificity factor subunit 4
Gene
Cpsf4, Cpsf30
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U) By similarity.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri35 – 6127C3H1-type 1
Add
BLAST
Zinc fingeri62 – 8928C3H1-type 2
Add
BLAST
Zinc fingeri111 – 13727C3H1-type 3
Add
BLAST
Zinc fingeri185 – 20218CCHC-type
Add
BLAST

GO - Molecular functioni

  1. RNA binding Source: UniProtKB-KW
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. mRNA processing Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

mRNA processing

Keywords - Ligandi

Metal-binding, RNA-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Cleavage and polyadenylation specificity factor subunit 4
Alternative name(s):
Cleavage and polyadenylation specificity factor 30 kDa subunit
Short name:
CPSF 30 kDa subunit
Clipper homolog
Clipper/CPSF 30K
Gene namesi
Name:Cpsf4
Synonyms:Cpsf30
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:1861602. Cpsf4.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. mRNA cleavage and polyadenylation specificity factor complex Source: UniProtKB
  2. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 211211Cleavage and polyadenylation specificity factor subunit 4
PRO_0000074403Add
BLAST

Proteomic databases

MaxQBiQ8BQZ5.
PaxDbiQ8BQZ5.
PRIDEiQ8BQZ5.

PTM databases

PhosphoSiteiQ8BQZ5.

Expressioni

Gene expression databases

ArrayExpressiQ8BQZ5.
BgeeiQ8BQZ5.
CleanExiMM_CPSF4.
GenevestigatoriQ8BQZ5.

Interactioni

Subunit structurei

Component of the cleavage and polyadenylation specificity factor (CPSF) complex, composed of CPSF1, CPSF2, CPSF3, CPSF4 and FIP1L1. Interacts with FIP1L1 By similarity.

Protein-protein interaction databases

BioGridi207591. 1 interaction.
MINTiMINT-89829.

Structurei

3D structure databases

ProteinModelPortaliQ8BQZ5.
SMRiQ8BQZ5. Positions 61-103.

Family & Domainsi

Sequence similaritiesi

Belongs to the CPSF4/YTH1 family.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5084.
GeneTreeiENSGT00390000009627.
HOGENOMiHOG000212457.
HOVERGENiHBG051108.
KOiK14404.
PhylomeDBiQ8BQZ5.
TreeFamiTF314871.

Family and domain databases

Gene3Di4.10.1000.10. 2 hits.
4.10.60.10. 1 hit.
InterProiIPR000571. Znf_CCCH.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00642. zf-CCCH. 2 hits.
PF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTiSM00343. ZnF_C2HC. 1 hit.
SM00356. ZnF_C3H1. 4 hits.
[Graphical view]
SUPFAMiSSF57756. SSF57756. 1 hit.
PROSITEiPS50103. ZF_C3H1. 3 hits.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8BQZ5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQEIIASVDH IKFDLEIAVE QQLGAQPLPF PGMDKSGAAV CEFFLKAACG    50
KGGMCPFRHI SGEKTVVCKH WLRGLCKKGD QCEFLHEYDM TKMPECYFYS 100
KFGPLCRHRH TRRVICVNYL VGFCPEGPSC KFMHPRFELP MGTTEQPPLP 150
QQTQPPTKRA PQVIGVMQSQ NSSAGNRGPR PLEQVTCYKC GEKGHYANRC 200
TKGHLAFLSG Q 211

Note: No experimental confirmation available.

Length:211
Mass (Da):23,653
Last modified:March 1, 2003 - v1
Checksum:iF5656741519E0E26
GO
Isoform 2 (identifier: Q8BQZ5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-103: G → GECSNKECPFLHIDPESKIKDCPWYDRGFCKHG
     158-158: K → KQ
     174-188: AGNRGPRPLEQVTCY → DSSSSSSSWNHCGAA
     189-211: Missing.

Show »
Length:221
Mass (Da):24,881
Checksum:i5DE80D92089DDC85
GO
Isoform 3 (identifier: Q8BQZ5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-103: G → GECSNKECPFLHIDPESKIKDCPWYDRGFCKHG
     159-180: RAPQVIGVMQSQNSSAGNRGPR → VLYPAASLATLACRDGLITHSV
     181-211: Missing.

Note: No experimental confirmation available.

Show »
Length:212
Mass (Da):23,958
Checksum:i75487F4FF13C64FB
GO

Sequence cautioni

The sequence AAC53567.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAH57067.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei103 – 1031G → GECSNKECPFLHIDPESKIK DCPWYDRGFCKHG in isoform 2 and isoform 3.
VSP_008603
Alternative sequencei158 – 1581K → KQ in isoform 2.
VSP_008604
Alternative sequencei159 – 18022RAPQV…NRGPR → VLYPAASLATLACRDGLITH SV in isoform 3.
VSP_008605Add
BLAST
Alternative sequencei174 – 18815AGNRG…QVTCY → DSSSSSSSWNHCGAA in isoform 2.
VSP_008606Add
BLAST
Alternative sequencei181 – 21131Missing in isoform 3.
VSP_008607Add
BLAST
Alternative sequencei189 – 21123Missing in isoform 2.
VSP_008608Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK046064 mRNA. Translation: BAC32587.1.
AF033201 mRNA. Translation: AAC53567.1. Different initiation.
BC057067 mRNA. Translation: AAH57067.1. Different initiation.
CCDSiCCDS19859.1. [Q8BQZ5-1]
RefSeqiNP_001278177.1. NM_001291248.1.
NP_001278178.1. NM_001291249.1.
NP_848671.1. NM_178576.3. [Q8BQZ5-1]
UniGeneiMm.196884.

Genome annotation databases

EnsembliENSMUST00000070487; ENSMUSP00000069243; ENSMUSG00000029625. [Q8BQZ5-1]
GeneIDi54188.
KEGGimmu:54188.
UCSCiuc009amj.1. mouse. [Q8BQZ5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK046064 mRNA. Translation: BAC32587.1 .
AF033201 mRNA. Translation: AAC53567.1 . Different initiation.
BC057067 mRNA. Translation: AAH57067.1 . Different initiation.
CCDSi CCDS19859.1. [Q8BQZ5-1 ]
RefSeqi NP_001278177.1. NM_001291248.1.
NP_001278178.1. NM_001291249.1.
NP_848671.1. NM_178576.3. [Q8BQZ5-1 ]
UniGenei Mm.196884.

3D structure databases

ProteinModelPortali Q8BQZ5.
SMRi Q8BQZ5. Positions 61-103.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 207591. 1 interaction.
MINTi MINT-89829.

PTM databases

PhosphoSitei Q8BQZ5.

Proteomic databases

MaxQBi Q8BQZ5.
PaxDbi Q8BQZ5.
PRIDEi Q8BQZ5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000070487 ; ENSMUSP00000069243 ; ENSMUSG00000029625 . [Q8BQZ5-1 ]
GeneIDi 54188.
KEGGi mmu:54188.
UCSCi uc009amj.1. mouse. [Q8BQZ5-1 ]

Organism-specific databases

CTDi 10898.
MGIi MGI:1861602. Cpsf4.

Phylogenomic databases

eggNOGi COG5084.
GeneTreei ENSGT00390000009627.
HOGENOMi HOG000212457.
HOVERGENi HBG051108.
KOi K14404.
PhylomeDBi Q8BQZ5.
TreeFami TF314871.

Miscellaneous databases

ChiTaRSi CPSF4. mouse.
NextBioi 311022.
PROi Q8BQZ5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8BQZ5.
Bgeei Q8BQZ5.
CleanExi MM_CPSF4.
Genevestigatori Q8BQZ5.

Family and domain databases

Gene3Di 4.10.1000.10. 2 hits.
4.10.60.10. 1 hit.
InterProi IPR000571. Znf_CCCH.
IPR001878. Znf_CCHC.
[Graphical view ]
Pfami PF00642. zf-CCCH. 2 hits.
PF00098. zf-CCHC. 1 hit.
[Graphical view ]
SMARTi SM00343. ZnF_C2HC. 1 hit.
SM00356. ZnF_C3H1. 4 hits.
[Graphical view ]
SUPFAMi SSF57756. SSF57756. 1 hit.
PROSITEi PS50103. ZF_C3H1. 3 hits.
PS50158. ZF_CCHC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Corpora quadrigemina.
  2. "Drosophila clipper/CPSF 30K is a post-transcriptionally regulated nuclear protein that binds RNA containing GC clusters."
    Bai C., Tolias P.P.
    Nucleic Acids Res. 26:1597-1604(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-211 (ISOFORM 2), FUNCTION.
    Strain: C57BL/6J.
    Tissue: Embryo.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 45-211 (ISOFORM 3).
    Strain: C57BL/6.
    Tissue: Brain.

Entry informationi

Entry nameiCPSF4_MOUSE
AccessioniPrimary (citable) accession number: Q8BQZ5
Secondary accession number(s): O54930
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 24, 2003
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi