Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8BQZ5 (CPSF4_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cleavage and polyadenylation specificity factor subunit 4
Alternative name(s):
Cleavage and polyadenylation specificity factor 30 kDa subunit
Short name=CPSF 30 kDa subunit
Clipper homolog
Clipper/CPSF 30K
Gene names
Name:Cpsf4
Synonyms:Cpsf30
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length211 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U) By similarity. Ref.2

Subunit structure

Component of the cleavage and polyadenylation specificity factor (CPSF) complex, composed of CPSF1, CPSF2, CPSF3, CPSF4 and FIP1L1. Interacts with FIP1L1 By similarity.

Subcellular location

Nucleus By similarity.

Sequence similarities

Belongs to the CPSF4/YTH1 family.

Contains 3 C3H1-type zinc fingers.

Contains 1 CCHC-type zinc finger.

Sequence caution

The sequence AAC53567.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH57067.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processmRNA processing
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainRepeat
Zinc-finger
   LigandMetal-binding
RNA-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmRNA processing

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentmRNA cleavage and polyadenylation specificity factor complex

Inferred from sequence or structural similarity. Source: UniProtKB

mitochondrion

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionRNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8BQZ5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q8BQZ5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     103-103: G → GECSNKECPFLHIDPESKIKDCPWYDRGFCKHG
     158-158: K → KQ
     174-188: AGNRGPRPLEQVTCY → DSSSSSSSWNHCGAA
     189-211: Missing.
Isoform 3 (identifier: Q8BQZ5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     103-103: G → GECSNKECPFLHIDPESKIKDCPWYDRGFCKHG
     159-180: RAPQVIGVMQSQNSSAGNRGPR → VLYPAASLATLACRDGLITHSV
     181-211: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 211211Cleavage and polyadenylation specificity factor subunit 4
PRO_0000074403

Regions

Zinc finger35 – 6127C3H1-type 1
Zinc finger62 – 8928C3H1-type 2
Zinc finger111 – 13727C3H1-type 3
Zinc finger185 – 20218CCHC-type

Natural variations

Alternative sequence1031G → GECSNKECPFLHIDPESKIK DCPWYDRGFCKHG in isoform 2 and isoform 3.
VSP_008603
Alternative sequence1581K → KQ in isoform 2.
VSP_008604
Alternative sequence159 – 18022RAPQV…NRGPR → VLYPAASLATLACRDGLITH SV in isoform 3.
VSP_008605
Alternative sequence174 – 18815AGNRG…QVTCY → DSSSSSSSWNHCGAA in isoform 2.
VSP_008606
Alternative sequence181 – 21131Missing in isoform 3.
VSP_008607
Alternative sequence189 – 21123Missing in isoform 2.
VSP_008608

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: F5656741519E0E26

FASTA21123,653
        10         20         30         40         50         60 
MQEIIASVDH IKFDLEIAVE QQLGAQPLPF PGMDKSGAAV CEFFLKAACG KGGMCPFRHI 

        70         80         90        100        110        120 
SGEKTVVCKH WLRGLCKKGD QCEFLHEYDM TKMPECYFYS KFGPLCRHRH TRRVICVNYL 

       130        140        150        160        170        180 
VGFCPEGPSC KFMHPRFELP MGTTEQPPLP QQTQPPTKRA PQVIGVMQSQ NSSAGNRGPR 

       190        200        210 
PLEQVTCYKC GEKGHYANRC TKGHLAFLSG Q 

« Hide

Isoform 2 [UniParc].

Checksum: 5DE80D92089DDC85
Show »

FASTA22124,881
Isoform 3 [UniParc].

Checksum: 75487F4FF13C64FB
Show »

FASTA21223,958

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Corpora quadrigemina.
[2]"Drosophila clipper/CPSF 30K is a post-transcriptionally regulated nuclear protein that binds RNA containing GC clusters."
Bai C., Tolias P.P.
Nucleic Acids Res. 26:1597-1604(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-211 (ISOFORM 2), FUNCTION.
Strain: C57BL/6J.
Tissue: Embryo.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 45-211 (ISOFORM 3).
Strain: C57BL/6.
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK046064 mRNA. Translation: BAC32587.1.
AF033201 mRNA. Translation: AAC53567.1. Different initiation.
BC057067 mRNA. Translation: AAH57067.1. Different initiation.
RefSeqNP_848671.1. NM_178576.2.
UniGeneMm.196884.

3D structure databases

ProteinModelPortalQ8BQZ5.
SMRQ8BQZ5. Positions 27-139.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-89829.

PTM databases

PhosphoSiteQ8BQZ5.

Proteomic databases

PaxDbQ8BQZ5.
PRIDEQ8BQZ5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000070487; ENSMUSP00000069243; ENSMUSG00000029625. [Q8BQZ5-1]
GeneID54188.
KEGGmmu:54188.
UCSCuc009amj.1. mouse. [Q8BQZ5-1]

Organism-specific databases

CTD10898.
MGIMGI:1861602. Cpsf4.

Phylogenomic databases

eggNOGCOG5084.
GeneTreeENSGT00390000009627.
HOGENOMHOG000212457.
HOVERGENHBG051108.
KOK14404.
PhylomeDBQ8BQZ5.
TreeFamTF314871.

Gene expression databases

ArrayExpressQ8BQZ5.
BgeeQ8BQZ5.
CleanExMM_CPSF4.
GenevestigatorQ8BQZ5.

Family and domain databases

Gene3D4.10.1000.10. 2 hits.
4.10.60.10. 1 hit.
InterProIPR000571. Znf_CCCH.
IPR001878. Znf_CCHC.
[Graphical view]
PfamPF00642. zf-CCCH. 2 hits.
PF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTSM00343. ZnF_C2HC. 1 hit.
SM00356. ZnF_C3H1. 4 hits.
[Graphical view]
SUPFAMSSF57756. SSF57756. 1 hit.
PROSITEPS50103. ZF_C3H1. 3 hits.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCPSF4. mouse.
NextBio311022.
PROQ8BQZ5.
SOURCESearch...

Entry information

Entry nameCPSF4_MOUSE
AccessionPrimary (citable) accession number: Q8BQZ5
Secondary accession number(s): O54930
Entry history
Integrated into UniProtKB/Swiss-Prot: October 24, 2003
Last sequence update: March 1, 2003
Last modified: April 16, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot