Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8BQY8 (HUS1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 89. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Checkpoint protein HUS1

Short name=mHUS1
Gene names
Name:Hus1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length280 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase By similarity.

Subunit structure

Component of the toroidal 9-1-1 (RAD9-RAD1-HUS1) complex, composed of RAD9A, RAD1 and HUS1. The 9-1-1 complex associates with LIG1, POLB, FEN1, RAD17, HDAC1, RPA1 and RPA2. The 9-1-1 complex associates with the RAD17-RFC complex. HUS1 interacts with POLB, HDAC1, FEN1, PCNA, RAD1, RAD9A and RAD9B. HUS1 does not interact with RAD17. Interacts with DNAJC7 By similarity.

Subcellular location

Nucleus By similarity. Cytoplasm By similarity. Note: In discrete nuclear foci upon DNA damage. DNA damage induces its nuclear translocation. Shuttles between the nucleus and the cytoplasm By similarity.

Tissue specificity

Ubiquitous. Ref.2

Sequence similarities

Belongs to the HUS1 family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8BQY8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8BQY8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     119-119: L → LQ
Isoform 3 (identifier: Q8BQY8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     119-119: L → LQ
     254-280: NIVNNRTVHFDLLLEDVSLQYFIPALS → SEFASPLSTSFVLHMQVCPVLAIELPETVRLERSLEPEVSRDAEEE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 280280Checkpoint protein HUS1
PRO_0000225004

Natural variations

Alternative sequence1191L → LQ in isoform 2 and isoform 3.
VSP_017332
Alternative sequence254 – 28027NIVNN…IPALS → SEFASPLSTSFVLHMQVCPV LAIELPETVRLERSLEPEVS RDAEEE in isoform 3.
VSP_017333

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2003. Version 1.
Checksum: 8721B79853E6150D

FASTA28031,680
        10         20         30         40         50         60 
MKFRAKIVDL ACLNHFTRVS NMIAKLAKTC TLRISPEKLN FILCDKLASG GVSMWCELEQ 

        70         80         90        100        110        120 
ENFFSEFQME GVSEENNEIY LELTSENLSR ALKTAQNSRA LKIKLTNKHF PCLTVSVELV 

       130        140        150        160        170        180 
SSSSSSRIVV HDIPIKVLPR RLWKDLQEPS IPDCDVSICL PALKMMKSVV EKMRNISNQL 

       190        200        210        220        230        240 
VIEANLKGEL NLKIETELVC VTTHFKDLEN PLLPSDSVSQ NRHPEDMAKV HIDIKKLLQF 

       250        260        270        280 
LAGQQVTPTK AVCNIVNNRT VHFDLLLEDV SLQYFIPALS 

« Hide

Isoform 2 [UniParc].

Checksum: E34F90D989912285
Show »

FASTA28131,808
Isoform 3 [UniParc].

Checksum: 947D0A24ECE9CB71
Show »

FASTA30033,848

References

« Hide 'large scale' references
[1]"cDNA cloning and gene mapping of human homologs for Schizosaccharomyces pombe rad17, rad1, and hus1 and cloning of homologs from mouse, Caenorhabditis elegans, and Drosophila melanogaster."
Dean F.B., Lian L., O'Donnell M.
Genomics 54:424-436(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"Mouse Hus1, a homologue of the Schizosaccharomyces pombe hus1+ cell cycle checkpoint gene."
Weiss R.S., Kostrub C.F., Enoch T., Leder P.
Genomics 59:32-39(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J and NOD.
Tissue: Corpora quadrigemina, Egg and Thymus.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Pituitary.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Y16894 mRNA. Translation: CAA76519.1.
AF076845 mRNA. Translation: AAC95527.1.
AK046152 mRNA. Translation: BAC32614.1.
AK088403 mRNA. Translation: BAC40332.1.
AK135922 mRNA. Translation: BAE22725.1.
AL669837 Genomic DNA. Translation: CAI24619.1.
BC061249 mRNA. Translation: AAH61249.1.
CCDSCCDS24429.1. [Q8BQY8-2]
RefSeqNP_032342.1. NM_008316.4. [Q8BQY8-2]
XP_006514594.1. XM_006514531.1. [Q8BQY8-3]
XP_006514595.1. XM_006514532.1. [Q8BQY8-1]
UniGeneMm.42201.

3D structure databases

ProteinModelPortalQ8BQY8.
SMRQ8BQY8. Positions 3-280.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ8BQY8.

Proteomic databases

PRIDEQ8BQY8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000020683; ENSMUSP00000020683; ENSMUSG00000020413. [Q8BQY8-2]
ENSMUST00000129115; ENSMUSP00000114339; ENSMUSG00000020413. [Q8BQY8-2]
GeneID15574.
KEGGmmu:15574.
UCSCuc007hzp.1. mouse. [Q8BQY8-1]
uc007hzq.1. mouse. [Q8BQY8-2]
uc007hzs.1. mouse. [Q8BQY8-3]

Organism-specific databases

CTD3364.
MGIMGI:1277962. Hus1.

Phylogenomic databases

eggNOGNOG250864.
GeneTreeENSGT00390000000706.
HOGENOMHOG000253011.
HOVERGENHBG053069.
InParanoidQ8BQY8.
KOK10903.
OMACMILYVY.
OrthoDBEOG780RN2.
PhylomeDBQ8BQY8.
TreeFamTF314491.

Gene expression databases

BgeeQ8BQY8.
CleanExMM_HUS1.
GenevestigatorQ8BQY8.

Family and domain databases

InterProIPR016580. Cell_cycle_HUS1.
IPR007150. Hus1/Mec3.
[Graphical view]
PANTHERPTHR12900. PTHR12900. 1 hit.
PfamPF04005. Hus1. 1 hit.
[Graphical view]
PIRSFPIRSF011312. Cell_cycle_HUS1. 1 hit.
ProtoNetSearch...

Other

NextBio288568.
PROQ8BQY8.
SOURCESearch...

Entry information

Entry nameHUS1_MOUSE
AccessionPrimary (citable) accession number: Q8BQY8
Secondary accession number(s): O70543, Q6P8H5
Entry history
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 1, 2003
Last modified: July 9, 2014
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot