Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8BQY8

- HUS1_MOUSE

UniProt

Q8BQY8 - HUS1_MOUSE

Protein

Checkpoint protein HUS1

Gene

Hus1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 1 (01 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase By similarity.By similarity

    GO - Biological processi

    1. cellular response to DNA damage stimulus Source: MGI
    2. cellular response to ionizing radiation Source: Ensembl
    3. DNA damage checkpoint Source: MGI
    4. double-strand break repair via homologous recombination Source: UniProtKB
    5. embryo development Source: UniProtKB
    6. mitotic cell cycle checkpoint Source: UniProtKB
    7. negative regulation of DNA replication Source: UniProtKB
    8. protein phosphorylation Source: MGI
    9. regulation of protein phosphorylation Source: UniProtKB
    10. response to UV Source: MGI

    Keywords - Biological processi

    DNA damage

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Checkpoint protein HUS1
    Short name:
    mHUS1
    Gene namesi
    Name:Hus1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1277962. Hus1.

    Subcellular locationi

    Nucleus By similarity. Cytoplasm By similarity
    Note: In discrete nuclear foci upon DNA damage. DNA damage induces its nuclear translocation. Shuttles between the nucleus and the cytoplasm By similarity.By similarity

    GO - Cellular componenti

    1. checkpoint clamp complex Source: InterPro
    2. Golgi apparatus Source: Ensembl
    3. nucleolus Source: Ensembl
    4. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 280280Checkpoint protein HUS1PRO_0000225004Add
    BLAST

    Proteomic databases

    PRIDEiQ8BQY8.

    PTM databases

    PhosphoSiteiQ8BQY8.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    BgeeiQ8BQY8.
    CleanExiMM_HUS1.
    GenevestigatoriQ8BQY8.

    Interactioni

    Subunit structurei

    Component of the toroidal 9-1-1 (RAD9-RAD1-HUS1) complex, composed of RAD9A, RAD1 and HUS1. The 9-1-1 complex associates with LIG1, POLB, FEN1, RAD17, HDAC1, RPA1 and RPA2. The 9-1-1 complex associates with the RAD17-RFC complex. HUS1 interacts with POLB, HDAC1, FEN1, PCNA, RAD1, RAD9A and RAD9B. HUS1 does not interact with RAD17. Interacts with DNAJC7 By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ8BQY8.
    SMRiQ8BQY8. Positions 3-280.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the HUS1 family.Curated

    Phylogenomic databases

    eggNOGiNOG250864.
    GeneTreeiENSGT00390000000706.
    HOGENOMiHOG000253011.
    HOVERGENiHBG053069.
    InParanoidiQ8BQY8.
    KOiK10903.
    OMAiCMILYVY.
    OrthoDBiEOG780RN2.
    PhylomeDBiQ8BQY8.
    TreeFamiTF314491.

    Family and domain databases

    InterProiIPR016580. Cell_cycle_HUS1.
    IPR007150. Hus1/Mec3.
    [Graphical view]
    PANTHERiPTHR12900. PTHR12900. 1 hit.
    PfamiPF04005. Hus1. 1 hit.
    [Graphical view]
    PIRSFiPIRSF011312. Cell_cycle_HUS1. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8BQY8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKFRAKIVDL ACLNHFTRVS NMIAKLAKTC TLRISPEKLN FILCDKLASG    50
    GVSMWCELEQ ENFFSEFQME GVSEENNEIY LELTSENLSR ALKTAQNSRA 100
    LKIKLTNKHF PCLTVSVELV SSSSSSRIVV HDIPIKVLPR RLWKDLQEPS 150
    IPDCDVSICL PALKMMKSVV EKMRNISNQL VIEANLKGEL NLKIETELVC 200
    VTTHFKDLEN PLLPSDSVSQ NRHPEDMAKV HIDIKKLLQF LAGQQVTPTK 250
    AVCNIVNNRT VHFDLLLEDV SLQYFIPALS 280
    Length:280
    Mass (Da):31,680
    Last modified:March 1, 2003 - v1
    Checksum:i8721B79853E6150D
    GO
    Isoform 2 (identifier: Q8BQY8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         119-119: L → LQ

    Show »
    Length:281
    Mass (Da):31,808
    Checksum:iE34F90D989912285
    GO
    Isoform 3 (identifier: Q8BQY8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         119-119: L → LQ
         254-280: NIVNNRTVHFDLLLEDVSLQYFIPALS → SEFASPLSTSFVLHMQVCPVLAIELPETVRLERSLEPEVSRDAEEE

    Note: No experimental confirmation available.

    Show »
    Length:300
    Mass (Da):33,848
    Checksum:i947D0A24ECE9CB71
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei119 – 1191L → LQ in isoform 2 and isoform 3. 4 PublicationsVSP_017332
    Alternative sequencei254 – 28027NIVNN…IPALS → SEFASPLSTSFVLHMQVCPV LAIELPETVRLERSLEPEVS RDAEEE in isoform 3. 1 PublicationVSP_017333Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y16894 mRNA. Translation: CAA76519.1.
    AF076845 mRNA. Translation: AAC95527.1.
    AK046152 mRNA. Translation: BAC32614.1.
    AK088403 mRNA. Translation: BAC40332.1.
    AK135922 mRNA. Translation: BAE22725.1.
    AL669837 Genomic DNA. Translation: CAI24619.1.
    BC061249 mRNA. Translation: AAH61249.1.
    CCDSiCCDS24429.1. [Q8BQY8-2]
    RefSeqiNP_032342.1. NM_008316.4. [Q8BQY8-2]
    XP_006514594.1. XM_006514531.1. [Q8BQY8-3]
    XP_006514595.1. XM_006514532.1. [Q8BQY8-1]
    UniGeneiMm.42201.

    Genome annotation databases

    EnsembliENSMUST00000020683; ENSMUSP00000020683; ENSMUSG00000020413. [Q8BQY8-2]
    ENSMUST00000129115; ENSMUSP00000114339; ENSMUSG00000020413. [Q8BQY8-2]
    GeneIDi15574.
    KEGGimmu:15574.
    UCSCiuc007hzp.1. mouse. [Q8BQY8-1]
    uc007hzq.1. mouse. [Q8BQY8-2]
    uc007hzs.1. mouse. [Q8BQY8-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y16894 mRNA. Translation: CAA76519.1 .
    AF076845 mRNA. Translation: AAC95527.1 .
    AK046152 mRNA. Translation: BAC32614.1 .
    AK088403 mRNA. Translation: BAC40332.1 .
    AK135922 mRNA. Translation: BAE22725.1 .
    AL669837 Genomic DNA. Translation: CAI24619.1 .
    BC061249 mRNA. Translation: AAH61249.1 .
    CCDSi CCDS24429.1. [Q8BQY8-2 ]
    RefSeqi NP_032342.1. NM_008316.4. [Q8BQY8-2 ]
    XP_006514594.1. XM_006514531.1. [Q8BQY8-3 ]
    XP_006514595.1. XM_006514532.1. [Q8BQY8-1 ]
    UniGenei Mm.42201.

    3D structure databases

    ProteinModelPortali Q8BQY8.
    SMRi Q8BQY8. Positions 3-280.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q8BQY8.

    Proteomic databases

    PRIDEi Q8BQY8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000020683 ; ENSMUSP00000020683 ; ENSMUSG00000020413 . [Q8BQY8-2 ]
    ENSMUST00000129115 ; ENSMUSP00000114339 ; ENSMUSG00000020413 . [Q8BQY8-2 ]
    GeneIDi 15574.
    KEGGi mmu:15574.
    UCSCi uc007hzp.1. mouse. [Q8BQY8-1 ]
    uc007hzq.1. mouse. [Q8BQY8-2 ]
    uc007hzs.1. mouse. [Q8BQY8-3 ]

    Organism-specific databases

    CTDi 3364.
    MGIi MGI:1277962. Hus1.

    Phylogenomic databases

    eggNOGi NOG250864.
    GeneTreei ENSGT00390000000706.
    HOGENOMi HOG000253011.
    HOVERGENi HBG053069.
    InParanoidi Q8BQY8.
    KOi K10903.
    OMAi CMILYVY.
    OrthoDBi EOG780RN2.
    PhylomeDBi Q8BQY8.
    TreeFami TF314491.

    Miscellaneous databases

    NextBioi 288568.
    PROi Q8BQY8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8BQY8.
    CleanExi MM_HUS1.
    Genevestigatori Q8BQY8.

    Family and domain databases

    InterProi IPR016580. Cell_cycle_HUS1.
    IPR007150. Hus1/Mec3.
    [Graphical view ]
    PANTHERi PTHR12900. PTHR12900. 1 hit.
    Pfami PF04005. Hus1. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF011312. Cell_cycle_HUS1. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning and gene mapping of human homologs for Schizosaccharomyces pombe rad17, rad1, and hus1 and cloning of homologs from mouse, Caenorhabditis elegans, and Drosophila melanogaster."
      Dean F.B., Lian L., O'Donnell M.
      Genomics 54:424-436(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "Mouse Hus1, a homologue of the Schizosaccharomyces pombe hus1+ cell cycle checkpoint gene."
      Weiss R.S., Kostrub C.F., Enoch T., Leder P.
      Genomics 59:32-39(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J and NOD.
      Tissue: Corpora quadrigemina, Egg and Thymus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Pituitary.

    Entry informationi

    Entry nameiHUS1_MOUSE
    AccessioniPrimary (citable) accession number: Q8BQY8
    Secondary accession number(s): O70543, Q6P8H5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 7, 2006
    Last sequence update: March 1, 2003
    Last modified: October 1, 2014
    This is version 90 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3