Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuropilin and tolloid-like protein 2

Gene

Neto2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Accessory subunit of neuronal kainate-sensitive glutamate receptors, GRIK2 and GRIK3. Increases kainate-receptor channel activity, slowing the decay kinetics of the receptors, without affecting their expression at the cell surface, and increasing the open probability of the receptor channels. Modulates the agonist sensitivity of kainate receptors. Slows the decay of kainate receptor-mediated excitatory postsynaptic currents (EPSCs), thus directly influencing synaptic transmission (By similarity).By similarity

GO - Molecular functioni

  • ionotropic glutamate receptor binding Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Neuropilin and tolloid-like protein 2
Alternative name(s):
Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2
Gene namesi
Name:Neto2
Synonyms:Btcl2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1921763. Neto2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini23 – 347325ExtracellularSequence analysisAdd
BLAST
Transmembranei348 – 36821HelicalSequence analysisAdd
BLAST
Topological domaini369 – 525157CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB-SubCell
  • postsynaptic density Source: MGI
  • synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222By similarityAdd
BLAST
Chaini23 – 525503Neuropilin and tolloid-like protein 2PRO_0000021802Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi45 ↔ 72By similarity
Disulfide bondi100 ↔ 122By similarity
Disulfide bondi177 ↔ 207By similarity
Disulfide bondi234 ↔ 256By similarity
Disulfide bondi297 ↔ 309By similarity
Disulfide bondi304 ↔ 322By similarity
Glycosylationi311 – 3111N-linked (GlcNAc...)Sequence analysis
Disulfide bondi316 ↔ 331By similarity
Modified residuei409 – 4091PhosphoserineCombined sources

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8BNJ6.
PaxDbiQ8BNJ6.
PRIDEiQ8BNJ6.

PTM databases

iPTMnetiQ8BNJ6.
PhosphoSiteiQ8BNJ6.

Expressioni

Tissue specificityi

Expressed in brain tissues, including cerebellar granule cells (at protein level).2 Publications

Developmental stagei

Observed restrictively in brain throughout embryonic (E) and postnatal stages (P). Expression pattern in brain slightly changes from E13 to P21.1 Publication

Gene expression databases

BgeeiQ8BNJ6.
CleanExiMM_NETO2.
GenevisibleiQ8BNJ6. MM.

Interactioni

Subunit structurei

Interacts with GRIK2 and GRIK3, but neither with AMPA-nor with NMDA-sensitive glutamate receptors.By similarity

GO - Molecular functioni

  • ionotropic glutamate receptor binding Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000105308.

Structurei

3D structure databases

ProteinModelPortaliQ8BNJ6.
SMRiQ8BNJ6. Positions 42-274.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 159115CUB 1PROSITE-ProRule annotationAdd
BLAST
Domaini177 – 292116CUB 2PROSITE-ProRule annotationAdd
BLAST
Domaini296 – 33237LDL-receptor class APROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 CUB domains.PROSITE-ProRule annotation
Contains 1 LDL-receptor class A domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGDK. Eukaryota.
ENOG41102J7. LUCA.
GeneTreeiENSGT00760000119018.
HOGENOMiHOG000060303.
HOVERGENiHBG052600.
InParanoidiQ8BNJ6.
OMAiHIPATQC.
OrthoDBiEOG7DFXBV.
PhylomeDBiQ8BNJ6.

Family and domain databases

Gene3Di2.60.120.290. 2 hits.
4.10.400.10. 1 hit.
InterProiIPR000859. CUB_dom.
IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR028868. NETO2.
[Graphical view]
PANTHERiPTHR10127:SF314. PTHR10127:SF314. 1 hit.
PfamiPF00431. CUB. 2 hits.
PF00057. Ldl_recept_a. 1 hit.
[Graphical view]
SMARTiSM00042. CUB. 2 hits.
SM00192. LDLa. 1 hit.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 2 hits.
SSF57424. SSF57424. 1 hit.
PROSITEiPS01180. CUB. 2 hits.
PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BNJ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALEQLCAVL KVLLITVLVV EGIAVAQKTQ DGQNIGIKHI PATQCGIWVR
60 70 80 90 100
TSNGGHFASP NYPDSYPPNK ECIYILEAAP RQRIELTFDE RYYIEPSFEC
110 120 130 140 150
RFDHLEIRDG PFGFSPLIDR YCGMKSPALI RSTGRFMWIK FSSDEELEGL
160 170 180 190 200
GFRAKYSFIP DPDFTYLGGI LNPIPDCQFE LSGADGIVRS SQVEQEEKTK
210 220 230 240 250
PGQAVDCIWT IKATPKAKIY LRFLDYQMEH SNECKRNFVA VYDGSSAIEN
260 270 280 290 300
LKAKFCSTVA NDVMLKTGVG VIRMWADEGS RLSRFRMLFT SFVEPPCTSS
310 320 330 340 350
TFFCHSNMCI NNSLVCNGVQ NCAYPWDENH CKEKKKAGLF EQITKTHGTI
360 370 380 390 400
IGITSGIVLV LLIISILVQV KQPRKKVMAC KTAFNKTGFQ EVFDPPHYEL
410 420 430 440 450
FSLREKEISA DLADLSEELD NYQKLRRSST ASRCIHDHHC GSQASSVKQS
460 470 480 490 500
RTNLSSMELP FRNDFAQPQP MKTFNSTFKK SSYTFKQAHE CPEQALEDRV
510 520
MEEIPCEIYV RGRDDSAQAS ISIDF
Length:525
Mass (Da):59,368
Last modified:March 1, 2003 - v1
Checksum:i3E02308F311EC5CE
GO
Isoform 2 (identifier: Q8BNJ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MALEQLCAVLK → MGTNAVTHSQTLGRAWGILWKNKDGMSQNDQGHHKKTYRINLPGPI
     169-175: Missing.

Show »
Length:553
Mass (Da):62,603
Checksum:i9B9AC3FCAF1049AF
GO

Sequence cautioni

The sequence BAC38225.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1111MALEQLCAVLK → MGTNAVTHSQTLGRAWGILW KNKDGMSQNDQGHHKKTYRI NLPGPI in isoform 2. 1 PublicationVSP_012858Add
BLAST
Alternative sequencei169 – 1757Missing in isoform 2. 1 PublicationVSP_012859

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY138991 mRNA. Translation: AAN38319.1.
AK081462 mRNA. Translation: BAC38225.1. Different initiation.
AK083512 mRNA. Translation: BAC38938.1.
BC151050 mRNA. Translation: AAI51051.1.
CCDSiCCDS40423.1. [Q8BNJ6-2]
RefSeqiNP_001074793.1. NM_001081324.1. [Q8BNJ6-2]
XP_006531500.1. XM_006531437.2. [Q8BNJ6-2]
XP_006531502.1. XM_006531439.2. [Q8BNJ6-1]
UniGeneiMm.126079.

Genome annotation databases

EnsembliENSMUST00000109686; ENSMUSP00000105308; ENSMUSG00000036902. [Q8BNJ6-2]
GeneIDi74513.
KEGGimmu:74513.
UCSCiuc009mqc.1. mouse. [Q8BNJ6-2]
uc009mqe.2. mouse. [Q8BNJ6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY138991 mRNA. Translation: AAN38319.1.
AK081462 mRNA. Translation: BAC38225.1. Different initiation.
AK083512 mRNA. Translation: BAC38938.1.
BC151050 mRNA. Translation: AAI51051.1.
CCDSiCCDS40423.1. [Q8BNJ6-2]
RefSeqiNP_001074793.1. NM_001081324.1. [Q8BNJ6-2]
XP_006531500.1. XM_006531437.2. [Q8BNJ6-2]
XP_006531502.1. XM_006531439.2. [Q8BNJ6-1]
UniGeneiMm.126079.

3D structure databases

ProteinModelPortaliQ8BNJ6.
SMRiQ8BNJ6. Positions 42-274.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000105308.

PTM databases

iPTMnetiQ8BNJ6.
PhosphoSiteiQ8BNJ6.

Proteomic databases

MaxQBiQ8BNJ6.
PaxDbiQ8BNJ6.
PRIDEiQ8BNJ6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000109686; ENSMUSP00000105308; ENSMUSG00000036902. [Q8BNJ6-2]
GeneIDi74513.
KEGGimmu:74513.
UCSCiuc009mqc.1. mouse. [Q8BNJ6-2]
uc009mqe.2. mouse. [Q8BNJ6-1]

Organism-specific databases

CTDi81831.
MGIiMGI:1921763. Neto2.

Phylogenomic databases

eggNOGiENOG410IGDK. Eukaryota.
ENOG41102J7. LUCA.
GeneTreeiENSGT00760000119018.
HOGENOMiHOG000060303.
HOVERGENiHBG052600.
InParanoidiQ8BNJ6.
OMAiHIPATQC.
OrthoDBiEOG7DFXBV.
PhylomeDBiQ8BNJ6.

Miscellaneous databases

ChiTaRSiNeto2. mouse.
PROiQ8BNJ6.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BNJ6.
CleanExiMM_NETO2.
GenevisibleiQ8BNJ6. MM.

Family and domain databases

Gene3Di2.60.120.290. 2 hits.
4.10.400.10. 1 hit.
InterProiIPR000859. CUB_dom.
IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR028868. NETO2.
[Graphical view]
PANTHERiPTHR10127:SF314. PTHR10127:SF314. 1 hit.
PfamiPF00431. CUB. 2 hits.
PF00057. Ldl_recept_a. 1 hit.
[Graphical view]
SMARTiSM00042. CUB. 2 hits.
SM00192. LDLa. 1 hit.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 2 hits.
SSF57424. SSF57424. 1 hit.
PROSITEiPS01180. CUB. 2 hits.
PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of Btcl2, a novel member of Btcl gene family, during development of the central nervous system."
    Michishita M., Ikeda T., Nakashiba T., Ogawa M., Tashiro K., Honjo T., Doi K., Itohara S., Endo S.
    Brain Res. Dev. Brain Res. 153:135-142(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), MEMBRANE TOPOLOGY, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: C57BL/6J.
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Head.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: TISSUE SPECIFICITY.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-409, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiNETO2_MOUSE
AccessioniPrimary (citable) accession number: Q8BNJ6
Secondary accession number(s): B2RX93, Q5VM49, Q8C4Q8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2003
Last modified: July 6, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.