Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/arginine-rich splicing factor 7

Gene

Srsf7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri133 – 15018CCHC-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

mRNA processing, mRNA splicing, mRNA transport, Transport

Keywords - Ligandi

Metal-binding, RNA-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-109688. Cleavage of Growing Transcript in the Termination Region.
R-MMU-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-MMU-72163. mRNA Splicing - Major Pathway.
R-MMU-72165. mRNA Splicing - Minor Pathway.
R-MMU-72187. mRNA 3'-end processing.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/arginine-rich splicing factor 7
Alternative name(s):
Splicing factor, arginine/serine-rich 7
Gene namesi
Name:Srsf7
Synonyms:Sfrs7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1926232. Srsf7.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 267267Serine/arginine-rich splicing factor 7PRO_0000081933Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei53 – 531N6-acetyllysineCombined sources
Modified residuei61 – 611PhosphoserineBy similarity
Modified residuei192 – 1921PhosphoserineBy similarity
Modified residuei194 – 1941PhosphoserineBy similarity
Modified residuei196 – 1961PhosphoserineBy similarity
Modified residuei210 – 2101PhosphoserineCombined sources
Modified residuei212 – 2121PhosphoserineCombined sources
Modified residuei221 – 2211PhosphoserineBy similarity
Modified residuei223 – 2231PhosphoserineBy similarity
Modified residuei225 – 2251PhosphoserineBy similarity
Modified residuei260 – 2601PhosphoserineBy similarity
Modified residuei262 – 2621PhosphoserineBy similarity

Post-translational modificationi

Extensively phosphorylated on serine residues in the RS domain.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8BL97.
PaxDbiQ8BL97.
PeptideAtlasiQ8BL97.
PRIDEiQ8BL97.

PTM databases

iPTMnetiQ8BL97.
PhosphoSiteiQ8BL97.

Expressioni

Gene expression databases

BgeeiENSMUSG00000024097.
CleanExiMM_SFRS7.
ExpressionAtlasiQ8BL97. baseline and differential.
GenevisibleiQ8BL97. MM.

Interactioni

Subunit structurei

Found in large molecular weight complexes containing CCNL1 and the p110 isoforms of either CDC2L1 or CDC2L2. Interacts with CCNL2 and CPSF6. Interacts with NXF1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Tra2aQ6PFR54EBI-913123,EBI-913075

Protein-protein interaction databases

BioGridi230352. 1 interaction.
DIPiDIP-36580N.
IntActiQ8BL97. 4 interactions.
MINTiMINT-1868398.
STRINGi10090.ENSMUSP00000070983.

Structurei

3D structure databases

ProteinModelPortaliQ8BL97.
SMRiQ8BL97. Positions 41-127.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini40 – 11374RRMPROSITE-ProRule annotationAdd
BLAST
Repeati182 – 18981
Repeati190 – 19782
Repeati198 – 20583
Repeati206 – 21384
Repeati240 – 24785; approximate
Repeati248 – 25586; approximate

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni110 – 12718Sufficient for interaction with NXF1By similarityAdd
BLAST
Regioni182 – 255746 X 8 AA repeats of R-R-S-R-S-X-S-XAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi150 – 267118Arg/Ser-rich (RS domain)Add
BLAST

Sequence similaritiesi

Belongs to the splicing factor SR family.Curated
Contains 1 CCHC-type zinc finger.PROSITE-ProRule annotation
Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri133 – 15018CCHC-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0107. Eukaryota.
ENOG4111N8Y. LUCA.
GeneTreeiENSGT00700000104103.
HOVERGENiHBG107480.
InParanoidiQ8BL97.
KOiK12896.
OMAiASPERMG.
TreeFamiTF351858.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
SSF57756. SSF57756. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Isoforms, lacking all or part of the RS domain, may be involved in modulating Srsf7 function.
Isoform 1 (identifier: Q8BL97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRSSARGRPL QAATAFFLSL FFFLRRFERG FWLWGGDSET KVYVGNLGTG
60 70 80 90 100
AGKGELERAF SYYGPLRTVW IARNPPGFAF VEFEDPRDAE DAVRGLDGKV
110 120 130 140 150
ICGSRVRVEL STGMPRRSRF DRPPARRPFD PNDRCYECGE KGHYAYDCHR
160 170 180 190 200
YSRRRRSRSR SRSHSRSRGR RYSRSRSRSR GRRSRSASPR RSRSVSLRRS
210 220 230 240 250
RSASLRRSRS GSIIGSRYFQ SRSRSRSRSR SISRPRSSRS KSRSPSPKRS
260
RSPSGSPHRS ASPERMD
Note: No experimental confirmation available.
Length:267
Mass (Da):30,818
Last modified:March 1, 2003 - v1
Checksum:iF193FC4C3A7D8C7C
GO
Isoform 2 (identifier: Q8BL97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG

Show »
Length:238
Mass (Da):27,378
Checksum:iCB56364C62C1276F
GO
Isoform 3 (identifier: Q8BL97-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG
     159-186: SRSRSHSRSRGRRYSRSRSRSRGRRSRS → YLINEGMVGILVNQSNSFISKAETSVFL
     187-267: Missing.

Show »
Length:157
Mass (Da):17,890
Checksum:i8095D63D190365FA
GO
Isoform 4 (identifier: Q8BL97-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG
     238-249: Missing.

Note: No experimental confirmation available.
Show »
Length:226
Mass (Da):26,023
Checksum:iB077E8D9F0FBDCF8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti155 – 1551R → T in BAC28058 (PubMed:16141072).Curated
Sequence conflicti208 – 2125SRSGS → FRFGF in AAH14857 (PubMed:15489334).Curated
Sequence conflicti218 – 2203Missing in BAC38650 (PubMed:16141072).Curated
Sequence conflicti231 – 2311S → F in AAH14857 (PubMed:15489334).Curated
Sequence conflicti251 – 2511R → C in AAH14857 (PubMed:15489334).Curated
Sequence conflicti258 – 2581H → P in AAH14857 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838MRSSA…WGGDS → MSRYGRYGG in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_013654Add
BLAST
Alternative sequencei159 – 18628SRSRS…RRSRS → YLINEGMVGILVNQSNSFIS KAETSVFL in isoform 3. 2 PublicationsVSP_013655Add
BLAST
Alternative sequencei187 – 26781Missing in isoform 3. 2 PublicationsVSP_013656Add
BLAST
Alternative sequencei238 – 24912Missing in isoform 4. 1 PublicationVSP_013657Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032861 mRNA. Translation: BAC28058.1.
AK045884 mRNA. Translation: BAC32521.1.
AK082848 mRNA. Translation: BAC38650.1.
BC014857 mRNA. Translation: AAH14857.1.
BC025529 mRNA. Translation: AAH25529.1.
BC027391 mRNA. Translation: AAH27391.1.
CCDSiCCDS28988.1. [Q8BL97-2]
RefSeqiNP_001182414.1. NM_001195485.1.
NP_001182415.1. NM_001195486.1.
NP_001182416.1. NM_001195487.1.
NP_666195.1. NM_146083.2. [Q8BL97-2]
XP_006524253.1. XM_006524190.1. [Q8BL97-4]
UniGeneiMm.292016.

Genome annotation databases

EnsembliENSMUST00000063417; ENSMUSP00000070983; ENSMUSG00000024097. [Q8BL97-2]
GeneIDi225027.
KEGGimmu:225027.
UCSCiuc008dqp.1. mouse. [Q8BL97-1]
uc008dqt.2. mouse. [Q8BL97-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032861 mRNA. Translation: BAC28058.1.
AK045884 mRNA. Translation: BAC32521.1.
AK082848 mRNA. Translation: BAC38650.1.
BC014857 mRNA. Translation: AAH14857.1.
BC025529 mRNA. Translation: AAH25529.1.
BC027391 mRNA. Translation: AAH27391.1.
CCDSiCCDS28988.1. [Q8BL97-2]
RefSeqiNP_001182414.1. NM_001195485.1.
NP_001182415.1. NM_001195486.1.
NP_001182416.1. NM_001195487.1.
NP_666195.1. NM_146083.2. [Q8BL97-2]
XP_006524253.1. XM_006524190.1. [Q8BL97-4]
UniGeneiMm.292016.

3D structure databases

ProteinModelPortaliQ8BL97.
SMRiQ8BL97. Positions 41-127.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi230352. 1 interaction.
DIPiDIP-36580N.
IntActiQ8BL97. 4 interactions.
MINTiMINT-1868398.
STRINGi10090.ENSMUSP00000070983.

PTM databases

iPTMnetiQ8BL97.
PhosphoSiteiQ8BL97.

Proteomic databases

MaxQBiQ8BL97.
PaxDbiQ8BL97.
PeptideAtlasiQ8BL97.
PRIDEiQ8BL97.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000063417; ENSMUSP00000070983; ENSMUSG00000024097. [Q8BL97-2]
GeneIDi225027.
KEGGimmu:225027.
UCSCiuc008dqp.1. mouse. [Q8BL97-1]
uc008dqt.2. mouse. [Q8BL97-4]

Organism-specific databases

CTDi6432.
MGIiMGI:1926232. Srsf7.

Phylogenomic databases

eggNOGiKOG0107. Eukaryota.
ENOG4111N8Y. LUCA.
GeneTreeiENSGT00700000104103.
HOVERGENiHBG107480.
InParanoidiQ8BL97.
KOiK12896.
OMAiASPERMG.
TreeFamiTF351858.

Enzyme and pathway databases

ReactomeiR-MMU-109688. Cleavage of Growing Transcript in the Termination Region.
R-MMU-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-MMU-72163. mRNA Splicing - Major Pathway.
R-MMU-72165. mRNA Splicing - Minor Pathway.
R-MMU-72187. mRNA 3'-end processing.

Miscellaneous databases

ChiTaRSiSrsf7. mouse.
PROiQ8BL97.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024097.
CleanExiMM_SFRS7.
ExpressionAtlasiQ8BL97. baseline and differential.
GenevisibleiQ8BL97. MM.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
SSF57756. SSF57756. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRSF7_MOUSE
AccessioniPrimary (citable) accession number: Q8BL97
Secondary accession number(s): Q8BMC6
, Q8BUR2, Q8R2N4, Q8R3E9, Q91YS1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.