Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/arginine-rich splicing factor 7

Gene

Srsf7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri133 – 150CCHC-typePROSITE-ProRule annotationAdd BLAST18

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

mRNA processing, mRNA splicing, mRNA transport, Transport

Keywords - Ligandi

Metal-binding, RNA-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-109688. Cleavage of Growing Transcript in the Termination Region.
R-MMU-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-MMU-72163. mRNA Splicing - Major Pathway.
R-MMU-72165. mRNA Splicing - Minor Pathway.
R-MMU-72187. mRNA 3'-end processing.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/arginine-rich splicing factor 7
Alternative name(s):
Splicing factor, arginine/serine-rich 7
Gene namesi
Name:Srsf7
Synonyms:Sfrs7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1926232. Srsf7.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000819331 – 267Serine/arginine-rich splicing factor 7Add BLAST267

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei53N6-acetyllysineCombined sources1
Modified residuei61PhosphoserineBy similarity1
Modified residuei192PhosphoserineBy similarity1
Modified residuei194PhosphoserineBy similarity1
Modified residuei196PhosphoserineBy similarity1
Modified residuei210PhosphoserineCombined sources1
Modified residuei212PhosphoserineCombined sources1
Modified residuei221PhosphoserineBy similarity1
Modified residuei223PhosphoserineBy similarity1
Modified residuei225PhosphoserineBy similarity1
Modified residuei260PhosphoserineBy similarity1
Modified residuei262PhosphoserineBy similarity1

Post-translational modificationi

Extensively phosphorylated on serine residues in the RS domain.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ8BL97.
PeptideAtlasiQ8BL97.
PRIDEiQ8BL97.

PTM databases

iPTMnetiQ8BL97.
PhosphoSitePlusiQ8BL97.

Expressioni

Gene expression databases

BgeeiENSMUSG00000024097.
CleanExiMM_SFRS7.
ExpressionAtlasiQ8BL97. baseline and differential.
GenevisibleiQ8BL97. MM.

Interactioni

Subunit structurei

Found in large molecular weight complexes containing CCNL1 and the p110 isoforms of either CDC2L1 or CDC2L2. Interacts with CCNL2 and CPSF6. Interacts with NXF1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Tra2aQ6PFR54EBI-913123,EBI-913075

Protein-protein interaction databases

BioGridi230352. 1 interactor.
DIPiDIP-36580N.
IntActiQ8BL97. 4 interactors.
MINTiMINT-1868398.
STRINGi10090.ENSMUSP00000070983.

Structurei

3D structure databases

ProteinModelPortaliQ8BL97.
SMRiQ8BL97.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 113RRMPROSITE-ProRule annotationAdd BLAST74
Repeati182 – 18918
Repeati190 – 19728
Repeati198 – 20538
Repeati206 – 21348
Repeati240 – 2475; approximate8
Repeati248 – 2556; approximate8

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni110 – 127Sufficient for interaction with NXF1By similarityAdd BLAST18
Regioni182 – 2556 X 8 AA repeats of R-R-S-R-S-X-S-XAdd BLAST74

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi150 – 267Arg/Ser-rich (RS domain)Add BLAST118

Sequence similaritiesi

Belongs to the splicing factor SR family.Curated
Contains 1 CCHC-type zinc finger.PROSITE-ProRule annotation
Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri133 – 150CCHC-typePROSITE-ProRule annotationAdd BLAST18

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0107. Eukaryota.
ENOG4111N8Y. LUCA.
GeneTreeiENSGT00700000104103.
HOVERGENiHBG107480.
InParanoidiQ8BL97.
KOiK12896.
OMAiASPERMG.
TreeFamiTF351858.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
SSF57756. SSF57756. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Isoforms, lacking all or part of the RS domain, may be involved in modulating Srsf7 function.
Isoform 1 (identifier: Q8BL97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRSSARGRPL QAATAFFLSL FFFLRRFERG FWLWGGDSET KVYVGNLGTG
60 70 80 90 100
AGKGELERAF SYYGPLRTVW IARNPPGFAF VEFEDPRDAE DAVRGLDGKV
110 120 130 140 150
ICGSRVRVEL STGMPRRSRF DRPPARRPFD PNDRCYECGE KGHYAYDCHR
160 170 180 190 200
YSRRRRSRSR SRSHSRSRGR RYSRSRSRSR GRRSRSASPR RSRSVSLRRS
210 220 230 240 250
RSASLRRSRS GSIIGSRYFQ SRSRSRSRSR SISRPRSSRS KSRSPSPKRS
260
RSPSGSPHRS ASPERMD
Note: No experimental confirmation available.
Length:267
Mass (Da):30,818
Last modified:March 1, 2003 - v1
Checksum:iF193FC4C3A7D8C7C
GO
Isoform 2 (identifier: Q8BL97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG

Show »
Length:238
Mass (Da):27,378
Checksum:iCB56364C62C1276F
GO
Isoform 3 (identifier: Q8BL97-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG
     159-186: SRSRSHSRSRGRRYSRSRSRSRGRRSRS → YLINEGMVGILVNQSNSFISKAETSVFL
     187-267: Missing.

Show »
Length:157
Mass (Da):17,890
Checksum:i8095D63D190365FA
GO
Isoform 4 (identifier: Q8BL97-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG
     238-249: Missing.

Note: No experimental confirmation available.
Show »
Length:226
Mass (Da):26,023
Checksum:iB077E8D9F0FBDCF8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti155R → T in BAC28058 (PubMed:16141072).Curated1
Sequence conflicti208 – 212SRSGS → FRFGF in AAH14857 (PubMed:15489334).Curated5
Sequence conflicti218 – 220Missing in BAC38650 (PubMed:16141072).Curated3
Sequence conflicti231S → F in AAH14857 (PubMed:15489334).Curated1
Sequence conflicti251R → C in AAH14857 (PubMed:15489334).Curated1
Sequence conflicti258H → P in AAH14857 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0136541 – 38MRSSA…WGGDS → MSRYGRYGG in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_013655159 – 186SRSRS…RRSRS → YLINEGMVGILVNQSNSFIS KAETSVFL in isoform 3. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_013656187 – 267Missing in isoform 3. 2 PublicationsAdd BLAST81
Alternative sequenceiVSP_013657238 – 249Missing in isoform 4. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032861 mRNA. Translation: BAC28058.1.
AK045884 mRNA. Translation: BAC32521.1.
AK082848 mRNA. Translation: BAC38650.1.
BC014857 mRNA. Translation: AAH14857.1.
BC025529 mRNA. Translation: AAH25529.1.
BC027391 mRNA. Translation: AAH27391.1.
CCDSiCCDS28988.1. [Q8BL97-2]
RefSeqiNP_001182414.1. NM_001195485.1.
NP_001182415.1. NM_001195486.1.
NP_001182416.1. NM_001195487.1.
NP_666195.1. NM_146083.2. [Q8BL97-2]
XP_006524253.1. XM_006524190.2. [Q8BL97-4]
UniGeneiMm.292016.

Genome annotation databases

EnsembliENSMUST00000063417; ENSMUSP00000070983; ENSMUSG00000024097. [Q8BL97-2]
GeneIDi225027.
KEGGimmu:225027.
UCSCiuc008dqp.1. mouse. [Q8BL97-1]
uc008dqt.2. mouse. [Q8BL97-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032861 mRNA. Translation: BAC28058.1.
AK045884 mRNA. Translation: BAC32521.1.
AK082848 mRNA. Translation: BAC38650.1.
BC014857 mRNA. Translation: AAH14857.1.
BC025529 mRNA. Translation: AAH25529.1.
BC027391 mRNA. Translation: AAH27391.1.
CCDSiCCDS28988.1. [Q8BL97-2]
RefSeqiNP_001182414.1. NM_001195485.1.
NP_001182415.1. NM_001195486.1.
NP_001182416.1. NM_001195487.1.
NP_666195.1. NM_146083.2. [Q8BL97-2]
XP_006524253.1. XM_006524190.2. [Q8BL97-4]
UniGeneiMm.292016.

3D structure databases

ProteinModelPortaliQ8BL97.
SMRiQ8BL97.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi230352. 1 interactor.
DIPiDIP-36580N.
IntActiQ8BL97. 4 interactors.
MINTiMINT-1868398.
STRINGi10090.ENSMUSP00000070983.

PTM databases

iPTMnetiQ8BL97.
PhosphoSitePlusiQ8BL97.

Proteomic databases

PaxDbiQ8BL97.
PeptideAtlasiQ8BL97.
PRIDEiQ8BL97.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000063417; ENSMUSP00000070983; ENSMUSG00000024097. [Q8BL97-2]
GeneIDi225027.
KEGGimmu:225027.
UCSCiuc008dqp.1. mouse. [Q8BL97-1]
uc008dqt.2. mouse. [Q8BL97-4]

Organism-specific databases

CTDi6432.
MGIiMGI:1926232. Srsf7.

Phylogenomic databases

eggNOGiKOG0107. Eukaryota.
ENOG4111N8Y. LUCA.
GeneTreeiENSGT00700000104103.
HOVERGENiHBG107480.
InParanoidiQ8BL97.
KOiK12896.
OMAiASPERMG.
TreeFamiTF351858.

Enzyme and pathway databases

ReactomeiR-MMU-109688. Cleavage of Growing Transcript in the Termination Region.
R-MMU-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-MMU-72163. mRNA Splicing - Major Pathway.
R-MMU-72165. mRNA Splicing - Minor Pathway.
R-MMU-72187. mRNA 3'-end processing.

Miscellaneous databases

ChiTaRSiSrsf7. mouse.
PROiQ8BL97.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024097.
CleanExiMM_SFRS7.
ExpressionAtlasiQ8BL97. baseline and differential.
GenevisibleiQ8BL97. MM.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
SSF57756. SSF57756. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRSF7_MOUSE
AccessioniPrimary (citable) accession number: Q8BL97
Secondary accession number(s): Q8BMC6
, Q8BUR2, Q8R2N4, Q8R3E9, Q91YS1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.