Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 22

Gene

Arhgap22

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in the signal transduction pathway that regulates endothelial cell capillary tube formation during angiogenesis. Acts as a GTPase activator for the RAC1 by converting it to an inactive GDP-bound state. Inhibits RAC1-dependent lamellipodia formation. May also play a role in transcription regulation via its interaction with VEZF1, by regulating activity of the endothelin-1 (EDN1) promoter.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, GTPase activation
Biological processAngiogenesis, Differentiation, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 22
Alternative name(s):
Rho-type GTPase-activating protein 22
p68RacGAP
Gene namesi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2443418. Arhgap22.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi201R → A: Loss of function. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804701 – 702Rho GTPase-activating protein 22Add BLAST702

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei365PhosphoserineBy similarity1
Modified residuei397PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BL80.
PeptideAtlasiQ8BL80.
PRIDEiQ8BL80.

2D gel databases

REPRODUCTION-2DPAGEiQ8BL80.

PTM databases

iPTMnetiQ8BL80.
PhosphoSitePlusiQ8BL80.

Expressioni

Tissue specificityi

Predominantly present in endothelial cells (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000063506.
CleanExiMM_ARHGAP22.
ExpressionAtlasiQ8BL80. baseline and differential.
GenevisibleiQ8BL80. MM.

Interactioni

Subunit structurei

Interacts with VEZF1.

Protein-protein interaction databases

BioGridi232034. 3 interactors.
CORUMiQ8BL80.
IntActiQ8BL80. 1 interactor.
STRINGi10090.ENSMUSP00000107587.

Structurei

3D structure databases

ProteinModelPortaliQ8BL80.
SMRiQ8BL80.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini43 – 151PHPROSITE-ProRule annotationAdd BLAST109
Domaini161 – 355Rho-GAPPROSITE-ProRule annotationAdd BLAST195

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili594 – 691Sequence analysisAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi437 – 584Ser-richAdd BLAST148

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8BL80.
KOiK20642.
OMAiHTEWALE.
OrthoDBiEOG091G02DD.
PhylomeDBiQ8BL80.
TreeFamiTF323577.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiView protein in InterPro
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
PfamiView protein in Pfam
PF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
SMARTiView protein in SMART
SM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiView protein in PROSITE
PS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BL80-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPTASSKRR TFAARYFTRS KSLVMGEQSR SPGRPLVPHK LGPVLKAGWL
60 70 80 90 100
RKQRSIMKNW QQRWFVLRGD QLFYYKDKDE SKPQGFISLQ GTQVTELLPD
110 120 130 140 150
PEDPGKHLFE ITPGGATERE KVPANPEALL LMASSQRDME DWVQAIRRVI
160 170 180 190 200
WAPLGRGIFG QRLEDTVHHE RKFGPRLAPL LVEQCVDFIR ERGLSEEGLF
210 220 230 240 250
RMPGQANLVR DLQDSFDCGE KPLFDSTTDV HTVASLLKLY LRELPEPVIP
260 270 280 290 300
FARYEDFLSC AQLLTKDEGE GTVELAKQVS NLPQANYNLL RYICKFLDEV
310 320 330 340 350
QAHSDVNKMS VQNLATVFGP NILRPQIEDP VTIMEGTSLV QHLMTVLIRK
360 370 380 390 400
HGQLFAATSL EEPASPHGTV EWGSEEVTRD HRGEPGSPGL PTHRTSSLDG
410 420 430 440 450
PAAAVLSRTS PPRLGSQTGP AATSPGKKMH TLPVWKSSFR QQGSRSESPK
460 470 480 490 500
GVNSSLEVPI ISSGGNWLIN GLSSLRSHRR ASSGDRLKDT GSAQRLSTYD
510 520 530 540 550
NVPPSSQFSS TASVASTSWS VASSSREASV SSCTACRASN SSACSSLHTE
560 570 580 590 600
WALEPSPLPS SSEGHQSPDL GHSLDEPCVG SGSSEPNDPG SPTQAHVRRC
610 620 630 640 650
RALQGQVAEL RAELCQQRTE YKRSLKSIEE GSADLRKQMS RLEEELDQER
660 670 680 690 700
KKYAMLEIKL RNSERAREDA ERRNQLLQRE MEEFFSTLGS LTTGTKGSRA

PE
Length:702
Mass (Da):77,786
Last modified:March 20, 2007 - v2
Checksum:i48D0D339C89C2BED
GO
Isoform 2 (identifier: Q8BL80-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.

Show »
Length:571
Mass (Da):62,840
Checksum:iF7CF8CABEC447418
GO
Isoform 3 (identifier: Q8BL80-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.
     226-295: STTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVELAKQVSNLPQANYNLLRYICK → R

Show »
Length:502
Mass (Da):55,086
Checksum:i6C622E19A42ED988
GO

Sequence cautioni

The sequence BAC32603 differs from that shown. Reason: Frameshift at position 48.Curated
The sequence BAC37178 differs from that shown. Reason: Frameshift at position 278.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti487L → R in BAC32603 (PubMed:16141072).Curated1
Sequence conflicti487L → R in BAC37178 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0237061 – 131Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST131
Alternative sequenceiVSP_023707226 – 295STTDV…RYICK → R in isoform 3. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY541447 mRNA. Translation: AAS47033.1.
AK046097 mRNA. Translation: BAC32603.1. Frameshift.
AK078218 mRNA. Translation: BAC37178.1. Frameshift.
BC038272 mRNA. Translation: AAH38272.1.
CCDSiCCDS26926.2. [Q8BL80-1]
RefSeqiNP_722495.3. NM_153800.4. [Q8BL80-1]
XP_011243355.1. XM_011245053.2. [Q8BL80-1]
UniGeneiMm.318350.

Genome annotation databases

EnsembliENSMUST00000111956; ENSMUSP00000107587; ENSMUSG00000063506. [Q8BL80-1]
GeneIDi239027.
KEGGimmu:239027.
UCSCiuc007szm.2. mouse. [Q8BL80-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRHG22_MOUSE
AccessioniPrimary (citable) accession number: Q8BL80
Secondary accession number(s): Q6QHH6, Q8BVH4, Q8CHY5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: September 27, 2017
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot