Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 22

Gene

Arhgap22

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Rho GTPase-activating protein involved in the signal transduction pathway that regulates endothelial cell capillary tube formation during angiogenesis. Acts as a GTPase activator for the RAC1 by converting it to an inactive GDP-bound state. Inhibits RAC1-dependent lamellipodia formation. May also play a role in transcription regulation via its interaction with VEZF1, by regulating activity of the endothelin-1 (EDN1) promoter.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, GTPase activation

Keywords - Biological processi

Angiogenesis, Differentiation, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 22
Alternative name(s):
Rho-type GTPase-activating protein 22
p68RacGAP
Gene namesi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2443418. Arhgap22.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi201 – 2011R → A: Loss of function. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 702702Rho GTPase-activating protein 22PRO_0000280470Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei365 – 3651PhosphoserineBy similarity
Modified residuei397 – 3971PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8BL80.
PaxDbiQ8BL80.
PeptideAtlasiQ8BL80.
PRIDEiQ8BL80.

2D gel databases

REPRODUCTION-2DPAGEQ8BL80.

PTM databases

iPTMnetiQ8BL80.
PhosphoSiteiQ8BL80.

Expressioni

Tissue specificityi

Predominantly present in endothelial cells (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000063506.
CleanExiMM_ARHGAP22.
ExpressionAtlasiQ8BL80. baseline and differential.
GenevisibleiQ8BL80. MM.

Interactioni

Subunit structurei

Interacts with VEZF1.

Protein-protein interaction databases

BioGridi232034. 3 interactions.
IntActiQ8BL80. 1 interaction.
STRINGi10090.ENSMUSP00000107587.

Structurei

3D structure databases

ProteinModelPortaliQ8BL80.
SMRiQ8BL80. Positions 42-149, 177-335.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini43 – 151109PHPROSITE-ProRule annotationAdd
BLAST
Domaini161 – 355195Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili594 – 69198Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi437 – 584148Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8BL80.
OMAiGEREKVP.
OrthoDBiEOG091G02DD.
PhylomeDBiQ8BL80.
TreeFamiTF323577.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BL80-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPTASSKRR TFAARYFTRS KSLVMGEQSR SPGRPLVPHK LGPVLKAGWL
60 70 80 90 100
RKQRSIMKNW QQRWFVLRGD QLFYYKDKDE SKPQGFISLQ GTQVTELLPD
110 120 130 140 150
PEDPGKHLFE ITPGGATERE KVPANPEALL LMASSQRDME DWVQAIRRVI
160 170 180 190 200
WAPLGRGIFG QRLEDTVHHE RKFGPRLAPL LVEQCVDFIR ERGLSEEGLF
210 220 230 240 250
RMPGQANLVR DLQDSFDCGE KPLFDSTTDV HTVASLLKLY LRELPEPVIP
260 270 280 290 300
FARYEDFLSC AQLLTKDEGE GTVELAKQVS NLPQANYNLL RYICKFLDEV
310 320 330 340 350
QAHSDVNKMS VQNLATVFGP NILRPQIEDP VTIMEGTSLV QHLMTVLIRK
360 370 380 390 400
HGQLFAATSL EEPASPHGTV EWGSEEVTRD HRGEPGSPGL PTHRTSSLDG
410 420 430 440 450
PAAAVLSRTS PPRLGSQTGP AATSPGKKMH TLPVWKSSFR QQGSRSESPK
460 470 480 490 500
GVNSSLEVPI ISSGGNWLIN GLSSLRSHRR ASSGDRLKDT GSAQRLSTYD
510 520 530 540 550
NVPPSSQFSS TASVASTSWS VASSSREASV SSCTACRASN SSACSSLHTE
560 570 580 590 600
WALEPSPLPS SSEGHQSPDL GHSLDEPCVG SGSSEPNDPG SPTQAHVRRC
610 620 630 640 650
RALQGQVAEL RAELCQQRTE YKRSLKSIEE GSADLRKQMS RLEEELDQER
660 670 680 690 700
KKYAMLEIKL RNSERAREDA ERRNQLLQRE MEEFFSTLGS LTTGTKGSRA

PE
Length:702
Mass (Da):77,786
Last modified:March 20, 2007 - v2
Checksum:i48D0D339C89C2BED
GO
Isoform 2 (identifier: Q8BL80-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.

Show »
Length:571
Mass (Da):62,840
Checksum:iF7CF8CABEC447418
GO
Isoform 3 (identifier: Q8BL80-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: Missing.
     226-295: STTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVELAKQVSNLPQANYNLLRYICK → R

Show »
Length:502
Mass (Da):55,086
Checksum:i6C622E19A42ED988
GO

Sequence cautioni

The sequence BAC32603 differs from that shown. Reason: Frameshift at position 48. Curated
The sequence BAC37178 differs from that shown. Reason: Frameshift at position 278. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti487 – 4871L → R in BAC32603 (PubMed:16141072).Curated
Sequence conflicti487 – 4871L → R in BAC37178 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 131131Missing in isoform 2 and isoform 3. 2 PublicationsVSP_023706Add
BLAST
Alternative sequencei226 – 29570STTDV…RYICK → R in isoform 3. 1 PublicationVSP_023707Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY541447 mRNA. Translation: AAS47033.1.
AK046097 mRNA. Translation: BAC32603.1. Frameshift.
AK078218 mRNA. Translation: BAC37178.1. Frameshift.
BC038272 mRNA. Translation: AAH38272.1.
CCDSiCCDS26926.2. [Q8BL80-1]
RefSeqiNP_722495.3. NM_153800.4. [Q8BL80-1]
XP_011243355.1. XM_011245053.1. [Q8BL80-1]
UniGeneiMm.318350.

Genome annotation databases

EnsembliENSMUST00000111956; ENSMUSP00000107587; ENSMUSG00000063506. [Q8BL80-1]
GeneIDi239027.
KEGGimmu:239027.
UCSCiuc007szm.2. mouse. [Q8BL80-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY541447 mRNA. Translation: AAS47033.1.
AK046097 mRNA. Translation: BAC32603.1. Frameshift.
AK078218 mRNA. Translation: BAC37178.1. Frameshift.
BC038272 mRNA. Translation: AAH38272.1.
CCDSiCCDS26926.2. [Q8BL80-1]
RefSeqiNP_722495.3. NM_153800.4. [Q8BL80-1]
XP_011243355.1. XM_011245053.1. [Q8BL80-1]
UniGeneiMm.318350.

3D structure databases

ProteinModelPortaliQ8BL80.
SMRiQ8BL80. Positions 42-149, 177-335.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi232034. 3 interactions.
IntActiQ8BL80. 1 interaction.
STRINGi10090.ENSMUSP00000107587.

PTM databases

iPTMnetiQ8BL80.
PhosphoSiteiQ8BL80.

2D gel databases

REPRODUCTION-2DPAGEQ8BL80.

Proteomic databases

MaxQBiQ8BL80.
PaxDbiQ8BL80.
PeptideAtlasiQ8BL80.
PRIDEiQ8BL80.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000111956; ENSMUSP00000107587; ENSMUSG00000063506. [Q8BL80-1]
GeneIDi239027.
KEGGimmu:239027.
UCSCiuc007szm.2. mouse. [Q8BL80-1]

Organism-specific databases

CTDi58504.
MGIiMGI:2443418. Arhgap22.

Phylogenomic databases

eggNOGiKOG4270. Eukaryota.
ENOG410XRR2. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000232151.
HOVERGENiHBG058875.
InParanoidiQ8BL80.
OMAiGEREKVP.
OrthoDBiEOG091G02DD.
PhylomeDBiQ8BL80.
TreeFamiTF323577.

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Miscellaneous databases

PROiQ8BL80.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000063506.
CleanExiMM_ARHGAP22.
ExpressionAtlasiQ8BL80. baseline and differential.
GenevisibleiQ8BL80. MM.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRHG22_MOUSE
AccessioniPrimary (citable) accession number: Q8BL80
Secondary accession number(s): Q6QHH6, Q8BVH4, Q8CHY5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: September 7, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.