Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-binding LIM protein 2

Gene

Ablim2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi83Zinc 1By similarity1
Metal bindingi86Zinc 1By similarity1
Metal bindingi103Zinc 1By similarity1
Metal bindingi106Zinc 1By similarity1
Metal bindingi109Zinc 2By similarity1
Metal bindingi112Zinc 2By similarity1
Metal bindingi131Zinc 2By similarity1
Metal bindingi134Zinc 2By similarity1
Metal bindingi212Zinc 3By similarity1
Metal bindingi215Zinc 3By similarity1
Metal bindingi232Zinc 3By similarity1
Metal bindingi235Zinc 3By similarity1
Metal bindingi238Zinc 4By similarity1
Metal bindingi241Zinc 4By similarity1
Metal bindingi260Zinc 4By similarity1
Metal bindingi263Zinc 4By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
Gene namesi
Name:Ablim2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2385758. Ablim2.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • myofibril Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000757001 – 612Actin-binding LIM protein 2Add BLAST612

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei282PhosphoserineBy similarity1
Modified residuei294PhosphoserineCombined sources1
Modified residuei365PhosphoserineBy similarity1
Modified residuei368PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei473PhosphothreonineCombined sources1
Modified residuei477PhosphoserineBy similarity1
Modified residuei579PhosphoserineBy similarity1
Isoform 4 (identifier: Q8BL65-4)
Modified residuei351PhosphoserineCombined sources1
Modified residuei356PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ8BL65.
PRIDEiQ8BL65.

PTM databases

iPTMnetiQ8BL65.
PhosphoSitePlusiQ8BL65.

Expressioni

Tissue specificityi

Expressed in brain. Highly expressed in caudate/putamen, moderately expressed in the olfactory bulb. In the hippocampus, expressed in the CA1, CA2 and CA3 fields. In the cerebellum, expressed in Purkinje cells.1 Publication

Developmental stagei

At 15.5 dpc, predominantly expressed in skeletal muscle tissue, including diaphragm, and to a lesser extent in the central nervous system.

Gene expression databases

BgeeiENSMUSG00000029095.
CleanExiMM_ABLIM2.
ExpressionAtlasiQ8BL65. baseline and differential.
GenevisibleiQ8BL65. MM.

Interactioni

Subunit structurei

Interacts with F-actin and ABRA.1 Publication

Protein-protein interaction databases

IntActiQ8BL65. 1 interactor.
MINTiMINT-4086540.

Structurei

3D structure databases

ProteinModelPortaliQ8BL65.
SMRiQ8BL65.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 81LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini81 – 141LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST61
Domaini151 – 210LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60
Domaini210 – 270LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST61
Domaini544 – 612HPPROSITE-ProRule annotationAdd BLAST69

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi364 – 412Ser-richAdd BLAST49

Sequence similaritiesi

Contains 1 HP (headpiece) domain.PROSITE-ProRule annotation
Contains 4 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

GeneTreeiENSGT00760000119039.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ8BL65.
KOiK07520.
PhylomeDBiQ8BL65.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR032402. AbLIM_anchor.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF16182. AbLIM_anchor. 2 hits.
PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BL65-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAVSQPQAA HAPLEKPAST AILCNTCGNV CKGEVLRVQN KYFHIRCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEHI CTRDYQRLYG TRCFSCDRFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKECM CQKCSPPTLL GNSAHVAQGL
160 170 180 190 200
RSCGGCGLEI KNGQALVALD KHWHLGCFKC KTCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHSKFGI RCDGCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFSEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DKSKETRTSS ESIVSVPASS TSGSPSRVIY
310 320 330 340 350
AKLGDEILDY RDLAALPKNK AIYNIDRPDM ISYSPYISHS AVGDRQSYGE
360 370 380 390 400
GDQDDRSYKQ CRTSSPSSAG SVSLGHYTPT SRSPQHYSRP GSESGRSTPS
410 420 430 440 450
LSVHSDSRPP SSTYQQAPRH FHVPDTGVKD NIYRKPPIYK QHAARRLDVE
460 470 480 490 500
DSSFDQDSRK KTTWLLLKGD ADTRTNSPDL DSQSLSLSSG TDQEPLQRMA
510 520 530 540 550
GDSLYSRFPY SKPDTLPGPR KDGLDLRNAN LAPCGADPDA SWGTREYKIY
560 570 580 590 600
PYDSLIVTNR IRVKLPKDVD RTRLERHLSP EEFQEVFGMS IEEFDRLALW
610
KRNDLKKKAL LF
Length:612
Mass (Da):68,107
Last modified:March 1, 2003 - v1
Checksum:i97FE5A9C049AD455
GO
Isoform 2 (identifier: Q8BL65-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:573
Mass (Da):63,897
Checksum:i961AA78804600F73
GO
Isoform 3 (identifier: Q8BL65-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-390: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:606
Mass (Da):67,499
Checksum:iFA48FAA83FEF32F1
GO
Isoform 4 (identifier: Q8BL65-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-350: E → ESPQLLSPTPTE
     390-390: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:617
Mass (Da):68,650
Checksum:i9E086F5C3C1D3CC8
GO
Isoform 5 (identifier: Q8BL65-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-390: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     507-526: RFPYSKPDTLPGPRKDGLDL → QCQPGPLWSRPGCQLGHARV
     527-612: Missing.

Show »
Length:559
Mass (Da):61,492
Checksum:i8DDA6349B9AF90AB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti305D → N in BAC32905 (PubMed:16141072).Curated1
Sequence conflicti406D → N in BAC32905 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_012120350E → ESPQLLSPTPTE in isoform 4. 1 Publication1
Alternative sequenceiVSP_012121390P → PAGTVSVGTSSCLSLSQHPS PTSVFRHHYIPYFR in isoform 3, isoform 4 and isoform 5. 3 Publications1
Alternative sequenceiVSP_012122507 – 546RFPYS…WGTRE → Q in isoform 2, isoform 3 and isoform 4. 4 PublicationsAdd BLAST40
Alternative sequenceiVSP_012123507 – 526RFPYS…DGLDL → QCQPGPLWSRPGCQLGHARV in isoform 5. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_012124527 – 612Missing in isoform 5. 1 PublicationAdd BLAST86

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ748602 mRNA. Translation: CAG38377.1.
AJ748603 mRNA. Translation: CAG38378.1.
AY274116 mRNA. Translation: AAP23233.1.
AK046243 mRNA. Translation: BAC32651.1.
AK046879 mRNA. Translation: BAC32905.1.
AK082707 mRNA. Translation: BAC38580.1.
BC141125 mRNA. Translation: AAI41126.1.
CCDSiCCDS19235.1. [Q8BL65-1]
CCDS51475.1. [Q8BL65-4]
CCDS51476.1. [Q8BL65-3]
CCDS51477.1. [Q8BL65-2]
RefSeqiNP_001171168.1. NM_001177697.1. [Q8BL65-4]
NP_001171170.1. NM_001177699.1. [Q8BL65-3]
NP_001171171.1. NM_001177700.1. [Q8BL65-2]
NP_808346.3. NM_177678.7. [Q8BL65-1]
UniGeneiMm.254446.

Genome annotation databases

EnsembliENSMUST00000054598; ENSMUSP00000050571; ENSMUSG00000029095. [Q8BL65-1]
ENSMUST00000114204; ENSMUSP00000109842; ENSMUSG00000029095. [Q8BL65-3]
ENSMUST00000114205; ENSMUSP00000109843; ENSMUSG00000029095. [Q8BL65-2]
ENSMUST00000114206; ENSMUSP00000109844; ENSMUSG00000029095. [Q8BL65-4]
ENSMUST00000114210; ENSMUSP00000109848; ENSMUSG00000029095. [Q8BL65-5]
GeneIDi231148.
KEGGimmu:231148.
UCSCiuc008xeg.2. mouse. [Q8BL65-1]
uc033iiv.1. mouse. [Q8BL65-2]
uc033iiw.1. mouse. [Q8BL65-4]
uc033iix.1. mouse. [Q8BL65-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ748602 mRNA. Translation: CAG38377.1.
AJ748603 mRNA. Translation: CAG38378.1.
AY274116 mRNA. Translation: AAP23233.1.
AK046243 mRNA. Translation: BAC32651.1.
AK046879 mRNA. Translation: BAC32905.1.
AK082707 mRNA. Translation: BAC38580.1.
BC141125 mRNA. Translation: AAI41126.1.
CCDSiCCDS19235.1. [Q8BL65-1]
CCDS51475.1. [Q8BL65-4]
CCDS51476.1. [Q8BL65-3]
CCDS51477.1. [Q8BL65-2]
RefSeqiNP_001171168.1. NM_001177697.1. [Q8BL65-4]
NP_001171170.1. NM_001177699.1. [Q8BL65-3]
NP_001171171.1. NM_001177700.1. [Q8BL65-2]
NP_808346.3. NM_177678.7. [Q8BL65-1]
UniGeneiMm.254446.

3D structure databases

ProteinModelPortaliQ8BL65.
SMRiQ8BL65.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BL65. 1 interactor.
MINTiMINT-4086540.

PTM databases

iPTMnetiQ8BL65.
PhosphoSitePlusiQ8BL65.

Proteomic databases

PeptideAtlasiQ8BL65.
PRIDEiQ8BL65.

Protocols and materials databases

DNASUi231148.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000054598; ENSMUSP00000050571; ENSMUSG00000029095. [Q8BL65-1]
ENSMUST00000114204; ENSMUSP00000109842; ENSMUSG00000029095. [Q8BL65-3]
ENSMUST00000114205; ENSMUSP00000109843; ENSMUSG00000029095. [Q8BL65-2]
ENSMUST00000114206; ENSMUSP00000109844; ENSMUSG00000029095. [Q8BL65-4]
ENSMUST00000114210; ENSMUSP00000109848; ENSMUSG00000029095. [Q8BL65-5]
GeneIDi231148.
KEGGimmu:231148.
UCSCiuc008xeg.2. mouse. [Q8BL65-1]
uc033iiv.1. mouse. [Q8BL65-2]
uc033iiw.1. mouse. [Q8BL65-4]
uc033iix.1. mouse. [Q8BL65-3]

Organism-specific databases

CTDi84448.
MGIiMGI:2385758. Ablim2.

Phylogenomic databases

GeneTreeiENSGT00760000119039.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ8BL65.
KOiK07520.
PhylomeDBiQ8BL65.

Miscellaneous databases

PROiQ8BL65.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029095.
CleanExiMM_ABLIM2.
ExpressionAtlasiQ8BL65. baseline and differential.
GenevisibleiQ8BL65. MM.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR032402. AbLIM_anchor.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF16182. AbLIM_anchor. 2 hits.
PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiABLM2_MOUSE
AccessioniPrimary (citable) accession number: Q8BL65
Secondary accession number(s): B2RUF8
, Q6H8P8, Q80WK6, Q8BUT1, Q8BXI7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.