Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger CCHC domain-containing protein 4

Gene

Zcchc4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

May be a methyltransferase.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri441 – 45818CCHC-typeAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Methyltransferase, Transferase

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger CCHC domain-containing protein 4
Gene namesi
Name:Zcchc4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1926046. Zcchc4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 512512Zinc finger CCHC domain-containing protein 4PRO_0000150953Add
BLAST

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

EPDiQ8BKW4.
MaxQBiQ8BKW4.
PaxDbiQ8BKW4.
PeptideAtlasiQ8BKW4.
PRIDEiQ8BKW4.

PTM databases

PhosphoSiteiQ8BKW4.

Expressioni

Gene expression databases

BgeeiQ8BKW4.
CleanExiMM_ZCCHC4.
ExpressionAtlasiQ8BKW4. baseline and differential.
GenevisibleiQ8BKW4. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000031077.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini393 – 44553DHHCPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 CCHC-type zinc finger.Curated
Contains 1 DHHC domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri441 – 45818CCHC-typeAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG4399. Eukaryota.
ENOG410XTH9. LUCA.
GeneTreeiENSGT00390000012556.
HOGENOMiHOG000230723.
HOVERGENiHBG056108.
InParanoidiQ8BKW4.
OMAiVNQGKEE.
PhylomeDBiQ8BKW4.
TreeFamiTF313872.

Family and domain databases

InterProiIPR002052. DNA_methylase_N6_adenine_CS.
IPR019369. Efm5.
IPR001594. Znf_DHHC_palmitoyltrfase.
IPR010666. Znf_GRF.
[Graphical view]
PfamiPF10237. N6-adenineMlase. 1 hit.
PF06839. zf-GRF. 1 hit.
[Graphical view]
PROSITEiPS50216. DHHC. 1 hit.
PS00092. N6_MTASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BKW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPMDCLES LEGDGDAGRR ASGVEVALPS NPTAPAPLCP HGPTLLFVKV
60 70 80 90 100
NQGKEETRKF YACSACRDRK DCNFFQWEDE KLSEARLAAR EIHNQKCQPP
110 120 130 140 150
LSRAQCIERY LSFIQLPLAQ RKFCQSCQQL LLPADWREHG THQLSADISV
160 170 180 190 200
AQLGRPSQLL YPLENKKTHA QYLFADRSCQ FLAGLLATLG FSRVLCVGAP
210 220 230 240 250
RLHEQIRLTA SGERSGMRSL LLDIDFRYSQ FYLEGSFCRY NMFNHHFFDG
260 270 280 290 300
KAALEVCKEF LQEEEGKGVI MVTDPPFGGL VEPLAITFKK LIAMWKEGQS
310 320 330 340 350
QDDSHKELPI FWIFPYFFES RICQFFPSFC MLDYQVDYDN HALYKHGKTG
360 370 380 390 400
RKQSPVRIFT NVPPNKIILP SEEGYRFCSL CQRYVSRENQ HCVHCNSCTS
410 420 430 440 450
KDGRKWSHCF LCKKCVKPSW IHCNTCNRCA LPDHSCLGPK DGCFICGALD
460 470 480 490 500
HKRSNCPNIG TSWRANKLVE FFGFLEKRLL MSSFLGAIYR STKLSEDSEF
510
FRVLNRSSHH YV
Length:512
Mass (Da):58,567
Last modified:March 1, 2003 - v1
Checksum:i8BBE0912790005C8
GO
Isoform 2 (identifier: Q8BKW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-512: LVEFFGFLEKRLLMSSFLGAIYRSTKLSEDSEFFRVLNRSSHHYV → AVRKQKQRKRNKIRREALKDNP

Note: No experimental confirmation available.
Show »
Length:489
Mass (Da):55,942
Checksum:i9B71C371895C3BE8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei468 – 51245LVEFF…SHHYV → AVRKQKQRKRNKIRREALKD NP in isoform 2. 1 PublicationVSP_017013Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019621 mRNA. Translation: BAB31816.1.
AK049511 mRNA. Translation: BAC33785.1.
AK138997 mRNA. Translation: BAE23854.1.
CCDSiCCDS39087.1. [Q8BKW4-1]
CCDS80282.1. [Q8BKW4-2]
RefSeqiNP_001295073.1. NM_001308144.1. [Q8BKW4-2]
NP_001296374.1. NM_001309445.1.
NP_084461.1. NM_030185.3. [Q8BKW4-1]
UniGeneiMm.266886.
Mm.462824.

Genome annotation databases

EnsembliENSMUST00000031077; ENSMUSP00000031077; ENSMUSG00000029179. [Q8BKW4-1]
ENSMUST00000113904; ENSMUSP00000109537; ENSMUSG00000029179. [Q8BKW4-2]
GeneIDi78796.
KEGGimmu:78796.
UCSCiuc008xku.1. mouse. [Q8BKW4-1]
uc008xkv.1. mouse. [Q8BKW4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019621 mRNA. Translation: BAB31816.1.
AK049511 mRNA. Translation: BAC33785.1.
AK138997 mRNA. Translation: BAE23854.1.
CCDSiCCDS39087.1. [Q8BKW4-1]
CCDS80282.1. [Q8BKW4-2]
RefSeqiNP_001295073.1. NM_001308144.1. [Q8BKW4-2]
NP_001296374.1. NM_001309445.1.
NP_084461.1. NM_030185.3. [Q8BKW4-1]
UniGeneiMm.266886.
Mm.462824.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000031077.

PTM databases

PhosphoSiteiQ8BKW4.

Proteomic databases

EPDiQ8BKW4.
MaxQBiQ8BKW4.
PaxDbiQ8BKW4.
PeptideAtlasiQ8BKW4.
PRIDEiQ8BKW4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000031077; ENSMUSP00000031077; ENSMUSG00000029179. [Q8BKW4-1]
ENSMUST00000113904; ENSMUSP00000109537; ENSMUSG00000029179. [Q8BKW4-2]
GeneIDi78796.
KEGGimmu:78796.
UCSCiuc008xku.1. mouse. [Q8BKW4-1]
uc008xkv.1. mouse. [Q8BKW4-2]

Organism-specific databases

CTDi29063.
MGIiMGI:1926046. Zcchc4.

Phylogenomic databases

eggNOGiKOG4399. Eukaryota.
ENOG410XTH9. LUCA.
GeneTreeiENSGT00390000012556.
HOGENOMiHOG000230723.
HOVERGENiHBG056108.
InParanoidiQ8BKW4.
OMAiVNQGKEE.
PhylomeDBiQ8BKW4.
TreeFamiTF313872.

Miscellaneous databases

ChiTaRSiZcchc4. mouse.
PROiQ8BKW4.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BKW4.
CleanExiMM_ZCCHC4.
ExpressionAtlasiQ8BKW4. baseline and differential.
GenevisibleiQ8BKW4. MM.

Family and domain databases

InterProiIPR002052. DNA_methylase_N6_adenine_CS.
IPR019369. Efm5.
IPR001594. Znf_DHHC_palmitoyltrfase.
IPR010666. Znf_GRF.
[Graphical view]
PfamiPF10237. N6-adenineMlase. 1 hit.
PF06839. zf-GRF. 1 hit.
[Graphical view]
PROSITEiPS50216. DHHC. 1 hit.
PS00092. N6_MTASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Aorta and Vein.

Entry informationi

Entry nameiZCHC4_MOUSE
AccessioniPrimary (citable) accession number: Q8BKW4
Secondary accession number(s): Q3UTX6, Q9D2I1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: March 1, 2003
Last modified: July 6, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.