Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Gene

Anks1b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal and transformed cells.By similarity

GO - Molecular functioni

GO - Biological processi

  • receptor localization to synapse Source: MGI
  • regulation of synaptic plasticity by receptor localization to synapse Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Alternative name(s):
Amyloid-beta protein intracellular domain-associated protein 1
Short name:
AIDA-1
E2A-PBX1-associated protein
Short name:
EB-1
Gene namesi
Name:Anks1b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1924781. Anks1b.

Subcellular locationi

Isoform 2 :

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12591259Ankyrin repeat and sterile alpha motif domain-containing protein 1BPRO_0000327260Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei310 – 3101PhosphoserineCombined sources
Modified residuei311 – 3111PhosphoserineCombined sources
Modified residuei315 – 3151PhosphoserineCombined sources
Modified residuei353 – 3531PhosphoserineCombined sources
Modified residuei364 – 3641PhosphoserineBy similarity
Modified residuei503 – 5031PhosphothreonineCombined sources
Modified residuei507 – 5071PhosphoserineCombined sources
Modified residuei510 – 5101PhosphoserineCombined sources
Modified residuei738 – 7381PhosphoserineCombined sources
Modified residuei772 – 7721PhosphothreonineBy similarity
Modified residuei774 – 7741PhosphoserineBy similarity
Modified residuei900 – 9001PhosphotyrosineCombined sources
Modified residuei973 – 9731PhosphoserineCombined sources
Modified residuei1006 – 10061PhosphotyrosineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8BIZ1.
PaxDbiQ8BIZ1.
PRIDEiQ8BIZ1.

PTM databases

iPTMnetiQ8BIZ1.
PhosphoSiteiQ8BIZ1.

Expressioni

Gene expression databases

BgeeiQ8BIZ1.

Interactioni

Subunit structurei

Interacts with EPHA8. Isoform 2 interacts with COIL (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000096968.

Structurei

3D structure databases

ProteinModelPortaliQ8BIZ1.
SMRiQ8BIZ1. Positions 811-945, 1052-1186.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati2 – 3130ANK 1Add
BLAST
Repeati58 – 8730ANK 2Add
BLAST
Repeati91 – 12030ANK 3Add
BLAST
Repeati127 – 15630ANK 4Add
BLAST
Repeati160 – 18930ANK 5Add
BLAST
Repeati193 – 22230ANK 6Add
BLAST
Repeati225 – 25430ANK 7Add
BLAST
Domaini809 – 87567SAM 1PROSITE-ProRule annotationAdd
BLAST
Domaini883 – 94866SAM 2PROSITE-ProRule annotationAdd
BLAST
Domaini1055 – 1212158PIDPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi934 – 9341Nuclear localization signalBy similarity

Sequence similaritiesi

Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 PID domain.PROSITE-ProRule annotation
Contains 2 SAM (sterile alpha motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0507. Eukaryota.
COG0666. LUCA.
HOGENOMiHOG000007214.
HOVERGENiHBG050506.
InParanoidiQ8BIZ1.

Family and domain databases

Gene3Di1.10.150.50. 2 hits.
1.25.40.20. 3 hits.
2.30.29.30. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PfamiPF12796. Ank_2. 3 hits.
PF00640. PID. 1 hit.
PF00536. SAM_1. 2 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
SM00462. PTB. 1 hit.
SM00454. SAM. 2 hits.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 2 hits.
SSF48403. SSF48403. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS01179. PID. 1 hit.
PS50105. SAM_DOMAIN. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BIZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKDQELLEA ARTGNVALVE KLLSGRKGGI LGGGSGPLPL SNLLSIWRGP
60 70 80 90 100
NVNCTDSSGY TALHHAALNG HKDIVLKLLQ YEASTNVADN KGYFPIHLAA
110 120 130 140 150
WKGDVEIVKI LIHHGPSHSR VNEQNNENET ALHCAAQYGH SEVVAVLLEE
160 170 180 190 200
LTDPTIRNSK LETPLDLAAL YGRLRVVKMI ISAHPNLMSC NTRKHTPLHL
210 220 230 240 250
AARNGHKAVV QVLLEAGMDV SCQTEKGSAL HEAALFGKVD VVRVLLETGI
260 270 280 290 300
DANIKDSLGR TVLDILKEHP SQKSLQIATL LQDYLEGAGR SAAVLEEHAQ
310 320 330 340 350
EDTAQETHLS SPAESPQKTK SETVTGELSK LLDEIKLCQE KDYSFEDLCH
360 370 380 390 400
TISDHYLDNL SKISEEELGK NGSQSVRTSS TINLSPGEVE DEEEDPNSCG
410 420 430 440 450
PTGLWEALTP CNGCRNLGFP MLAQESYPKK RNFPMEMEPS ASLDTFPSEN
460 470 480 490 500
ENFLCELVDT AVTKKPCSLE IARAPSPRTD NASEVAITAP GTSHHRNSST
510 520 530 540 550
GPTPDCSPPS PDTALKNIVK VIRPQPKQRT SIVSSLDFQR MNHNQEYFEI
560 570 580 590 600
STSTGCTSFT SSPAASPPTS SVETTEVKNE GAEHADDLSQ QEDDEPPKEY
610 620 630 640 650
DAGQFAGLLH GSSPACESPE NPFHLYGKRN TCEDGPDEAS LANSPLPFKQ
660 670 680 690 700
TPIENNPEPS VKKVKPKVVS RTIFHKRNHQ LENHTIVGTR MSRSGSRNGD
710 720 730 740 750
QWGVNPGGFV ERACTLGRIR SLPKALIDMH LSKNVSKSDS DLIAYPSKDK
760 770 780 790 800
ARVNWSKSST AERSSKDNSE RTPSFTSEWE EIDKIMNSID VGINSELEGM
810 820 830 840 850
NGETTRPRCP VQTVGQWLES IGLPQYENHL MANGFDSVQF MGSNVMEDQD
860 870 880 890 900
LLEIGILNSG HRQRILQAIQ LLPKMRPIGH DGYHPTSVAE WLDSIELGDY
910 920 930 940 950
TKAFLINGYT SMDLLKKIWE LELINVLKIS LIGHRKRILA SLGDRLHDDP
960 970 980 990 1000
PQKPPRSITL REPSGNHTPP QLSPSLSQST YTTGGSLDVP HIIMQGDARR
1010 1020 1030 1040 1050
RRNENYFDDI PRSKLERQMA QTGDWGEPSI TLRPPNEATA STPVQYWQHH
1060 1070 1080 1090 1100
PEKLIFQSCD YKAFYLGSML IKELRGTEST QDACAKMRAN CRKSTEQMKK
1110 1120 1130 1140 1150
VPTIILSVSY KGVKFIDAAN KNIIAEHEIR NISCAAQDPE DLSTFAYITK
1160 1170 1180 1190 1200
DLKSNHHYCH VFTAFDVNLA YEIILTLGQA FEVAYQLALQ ARKGGHSSTL
1210 1220 1230 1240 1250
PESFENKPSK PIPKPRVSIR KSVQIDPSEQ KTLANLPWIV EPGQEAKRGI

NTKYETTIF
Length:1,259
Mass (Da):139,047
Last modified:July 27, 2011 - v3
Checksum:i90956D38BF970B1C
GO
Isoform 2 (identifier: Q8BIZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-773: Missing.
     774-806: SFTSEWEEIDKIMNSIDVGINSELEGMNGETTR → MMWQCHPSAPDYRYYPVDGYSLLKRFPLHPLTG
     962-1021: Missing.

Show »
Length:426
Mass (Da):48,342
Checksum:i5870A4FE4DD6D56E
GO
Isoform 3 (identifier: Q8BIZ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-830: Missing.
     1224-1259: QIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF → APQTSCPNRLV

Show »
Length:404
Mass (Da):45,506
Checksum:i32FA628FFD6A3F98
GO
Isoform 4 (identifier: Q8BIZ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-773: Missing.
     774-806: SFTSEWEEIDKIMNSIDVGINSELEGMNGETTR → MMWQCHPSAPDYRYYPVDGYSLLKRFPLHPLTG
     962-1021: EPSGNHTPPQ...RSKLERQMAQ → QSSVCEIWTNQNAGFPFSAIHQVHN

Show »
Length:451
Mass (Da):51,140
Checksum:iF729B371BA91F73A
GO
Isoform 5 (identifier: Q8BIZ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-993: Missing.

Show »
Length:266
Mass (Da):30,268
Checksum:iAC5EFC1AC4CF8EB5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1092 – 10921R → Q in BAC27677 (PubMed:16141072).Curated
Sequence conflicti1092 – 10921R → Q in BAC27761 (PubMed:16141072).Curated
Sequence conflicti1092 – 10921R → Q in BAC33978 (PubMed:16141072).Curated
Sequence conflicti1092 – 10921R → Q in BAE37478 (PubMed:16141072).Curated
Sequence conflicti1092 – 10921R → Q in AAH98373 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 993993Missing in isoform 5. 1 PublicationVSP_032713Add
BLAST
Alternative sequencei1 – 830830Missing in isoform 3. 1 PublicationVSP_032714Add
BLAST
Alternative sequencei1 – 773773Missing in isoform 2 and isoform 4. 1 PublicationVSP_032715Add
BLAST
Alternative sequencei774 – 80633SFTSE…GETTR → MMWQCHPSAPDYRYYPVDGY SLLKRFPLHPLTG in isoform 2 and isoform 4. 1 PublicationVSP_032716Add
BLAST
Alternative sequencei962 – 102160Missing in isoform 2. 1 PublicationVSP_032717Add
BLAST
Alternative sequencei962 – 102160EPSGN…RQMAQ → QSSVCEIWTNQNAGFPFSAI HQVHN in isoform 4. 1 PublicationVSP_032718Add
BLAST
Alternative sequencei1224 – 125936QIDPS…ETTIF → APQTSCPNRLV in isoform 3. 1 PublicationVSP_032719Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032061 mRNA. Translation: BAC27677.1.
AK032211 mRNA. Translation: BAC27761.1.
AK049899 mRNA. Translation: BAC33978.1.
AK163750 mRNA. Translation: BAE37478.1.
AC107661 Genomic DNA. No translation available.
AC122212 Genomic DNA. No translation available.
AC132093 Genomic DNA. No translation available.
AC132131 Genomic DNA. No translation available.
AC132328 Genomic DNA. No translation available.
AC132465 Genomic DNA. No translation available.
AC138719 Genomic DNA. No translation available.
AC151984 Genomic DNA. No translation available.
AC134539 Genomic DNA. No translation available.
BC098373 mRNA. Translation: AAH98373.1.
CCDSiCCDS59552.1. [Q8BIZ1-4]
CCDS59553.1. [Q8BIZ1-2]
CCDS59554.1. [Q8BIZ1-3]
RefSeqiNP_001170867.1. NM_001177396.1.
NP_001170868.1. NM_001177397.1.
NP_001170869.1. NM_001177398.1.
NP_852063.1. NM_181398.3.
XP_006514377.1. XM_006514314.2.
XP_006514378.1. XM_006514315.1.
UniGeneiMm.440605.

Genome annotation databases

GeneIDi77531.
KEGGimmu:77531.
UCSCiuc033fry.1. mouse. [Q8BIZ1-4]
uc033frz.1. mouse. [Q8BIZ1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032061 mRNA. Translation: BAC27677.1.
AK032211 mRNA. Translation: BAC27761.1.
AK049899 mRNA. Translation: BAC33978.1.
AK163750 mRNA. Translation: BAE37478.1.
AC107661 Genomic DNA. No translation available.
AC122212 Genomic DNA. No translation available.
AC132093 Genomic DNA. No translation available.
AC132131 Genomic DNA. No translation available.
AC132328 Genomic DNA. No translation available.
AC132465 Genomic DNA. No translation available.
AC138719 Genomic DNA. No translation available.
AC151984 Genomic DNA. No translation available.
AC134539 Genomic DNA. No translation available.
BC098373 mRNA. Translation: AAH98373.1.
CCDSiCCDS59552.1. [Q8BIZ1-4]
CCDS59553.1. [Q8BIZ1-2]
CCDS59554.1. [Q8BIZ1-3]
RefSeqiNP_001170867.1. NM_001177396.1.
NP_001170868.1. NM_001177397.1.
NP_001170869.1. NM_001177398.1.
NP_852063.1. NM_181398.3.
XP_006514377.1. XM_006514314.2.
XP_006514378.1. XM_006514315.1.
UniGeneiMm.440605.

3D structure databases

ProteinModelPortaliQ8BIZ1.
SMRiQ8BIZ1. Positions 811-945, 1052-1186.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000096968.

PTM databases

iPTMnetiQ8BIZ1.
PhosphoSiteiQ8BIZ1.

Proteomic databases

MaxQBiQ8BIZ1.
PaxDbiQ8BIZ1.
PRIDEiQ8BIZ1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi77531.
KEGGimmu:77531.
UCSCiuc033fry.1. mouse. [Q8BIZ1-4]
uc033frz.1. mouse. [Q8BIZ1-2]

Organism-specific databases

CTDi56899.
MGIiMGI:1924781. Anks1b.

Phylogenomic databases

eggNOGiKOG0507. Eukaryota.
COG0666. LUCA.
HOGENOMiHOG000007214.
HOVERGENiHBG050506.
InParanoidiQ8BIZ1.

Miscellaneous databases

ChiTaRSiAnks1b. mouse.
NextBioi347068.
PROiQ8BIZ1.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BIZ1.

Family and domain databases

Gene3Di1.10.150.50. 2 hits.
1.25.40.20. 3 hits.
2.30.29.30. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PfamiPF12796. Ank_2. 3 hits.
PF00640. PID. 1 hit.
PF00536. SAM_1. 2 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
SM00462. PTB. 1 hit.
SM00454. SAM. 2 hits.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 2 hits.
SSF48403. SSF48403. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS01179. PID. 1 hit.
PS50105. SAM_DOMAIN. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
    Strain: C57BL/6J.
    Tissue: Corpus striatum, Hippocampus, Medulla oblongata and Olfactory bulb.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "Identification and verification of novel rodent postsynaptic density proteins."
    Jordan B.A., Fernholz B.D., Boussac M., Xu C., Grigorean G., Ziff E.B., Neubert T.A.
    Mol. Cell. Proteomics 3:857-871(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY (ISOFORM 4), SUBCELLULAR LOCATION.
  5. "Identification of phosphotyrosine binding domain-containing proteins as novel downstream targets of the EphA8 signaling function."
    Shin J., Gu C., Park E., Park S.
    Mol. Cell. Biol. 27:8113-8126(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EPHA8.
  6. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-900 AND TYR-1006, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-310; SER-311; SER-315; SER-353; THR-503; SER-507; SER-510; SER-738 AND SER-973, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiANS1B_MOUSE
AccessioniPrimary (citable) accession number: Q8BIZ1
Secondary accession number(s): E9Q644
, Q4KMR9, Q8BJ47, Q8BJ49
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: July 27, 2011
Last modified: May 11, 2016
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.