Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dedicator of cytokinesis protein 9

Gene

Dock9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide-exchange factor (GEF) that activates CDC42 by exchanging bound GDP for free GTP (PubMed:25851601). Overexpression induces filopodia formation (By similarity).By similarity1 Publication

Miscellaneous

'Zizim' means 'spike' in Hebrew.Curated

GO - Molecular functioni

  • cadherin binding Source: MGI
  • guanyl-nucleotide exchange factor activity Source: UniProtKB
  • Rho GTPase binding Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Dedicator of cytokinesis protein 9
Alternative name(s):
Cdc42 guanine nucleotide exchange factor zizimin-1
Short name:
Zizimin-11 Publication
Gene namesi
Name:Dock9Imported
Synonyms:D14Wsu89e, Kiaa1058, Ziz1Curated
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi

Organism-specific databases

MGIiMGI:106321 Dock9

Subcellular locationi

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001900001 – 2055Dedicator of cytokinesis protein 9Add BLAST2055

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei178PhosphoserineCombined sources1
Modified residuei181PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Modified residuei453PhosphoserineCombined sources1
Modified residuei936PhosphoserineBy similarity1
Modified residuei1244PhosphoserineBy similarity1
Modified residuei1250PhosphothreonineBy similarity1
Modified residuei1264PhosphoserineBy similarity1
Modified residuei1270PhosphoserineCombined sources1
Modified residuei1273PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8BIK4
PaxDbiQ8BIK4
PeptideAtlasiQ8BIK4
PRIDEiQ8BIK4

PTM databases

iPTMnetiQ8BIK4
PhosphoSitePlusiQ8BIK4

Expressioni

Tissue specificityi

Expressed in lung (PubMed:25729399, PubMed:22494997). Also detected in Peyers patches, thymus, brain and lymph nodes (PubMed:22494997). Expressed in Purkinje cells (PubMed:25851601).3 Publications

Gene expression databases

CleanExiMM_DOCK9

Interactioni

Subunit structurei

Homodimer. Interacts preferentially with nucleotide-depleted CDC42 (By similarity).By similarity

GO - Molecular functioni

  • cadherin binding Source: MGI
  • guanyl-nucleotide exchange factor activity Source: UniProtKB
  • Rho GTPase binding Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047881

Structurei

3D structure databases

ProteinModelPortaliQ8BIK4
SMRiQ8BIK4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini185 – 292PHPROSITE-ProRule annotationAdd BLAST108
Domaini649 – 827DHR-1PROSITE-ProRule annotationAdd BLAST179
Domaini1614 – 2055DHR-2PROSITE-ProRule annotationAdd BLAST442

Domaini

The DHR-2 domain is necessary and sufficient for the GEF activity.1 Publication

Sequence similaritiesi

Belongs to the DOCK family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
HOGENOMiHOG000231373
HOVERGENiHBG107819
InParanoidiQ8BIK4
PhylomeDBiQ8BIK4

Family and domain databases

CDDicd08697 C2_Dock-D, 1 hit
Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR026796 DOCK9
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR23317 PTHR23317, 1 hit
PTHR23317:SF77 PTHR23317:SF77, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SUPFAMiSSF48371 SSF48371, 4 hits
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BIK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCTTSVILF KGIRTVFERN CAYMCKQPGE SNALEYTAYN WSKEDSELSI
60 70 80 90 100
AFCLAKPKLI EPLDYENVIV QKKTQILNDC LREMLLFPYD DFQTAILRRQ
110 120 130 140 150
GRYLRSTVPA NAEEEAQSLF VTECIKTYNS DWHLVTYKYE DYSGEFRQLP
160 170 180 190 200
NKVPKLDKLP VHVYEVDEEA DKDEDAASLG SQKGGITKHG WLYKGNMNSA
210 220 230 240 250
ISVTMRSFKR RFFHLIQLGD GSYNLNFYKD EKISKEPKGS IFLDSCMGVI
260 270 280 290 300
QNNRVRRFAF ELKMQDKSSY LLAADSEAEM EEWVTVLNKI LQLNFEAAMQ
310 320 330 340 350
EKRNGDPHED DEQSKLEGSG SGLDSYLPEL AKSTREAEIK LKSESRVKLF
360 370 380 390 400
YLDPDTQKLD FSSAEPEVKP FEEKFGKRIL VKCNDLSFNL QCCVAENEEG
410 420 430 440 450
PTTNVEPFFV TLSLFDIKYN RKISADFHVD LNHFSVRQML APTSPALMNG
460 470 480 490 500
GQSPPAFQDA LHTAMQYPKQ GIFSVTCPHP DIFLVARIEK VLQGSITHCA
510 520 530 540 550
EPYMRSSDSS KVAQKVLKNA KQACQRLGQY RMPFAWAART LFKDTSGNLD
560 570 580 590 600
KNARFSAIYR QDSNKLSNDD MLKLLADFRK PEKMAKLPVI LGNLDITIDS
610 620 630 640 650
VSCDFPNYLN SSYIPMRQFE TCSKSPITFE VEEFVPCIPK HTQPYTVYSN
660 670 680 690 700
HLYVYPKYLK YDSQKSFAKA RNIAICIEFK DSDEEDSQPL KCIYGRPGGP
710 720 730 740 750
VFTRSALAAV LHHQQNPEFY DEIKIELPAQ LHERHHLLFT FFHVSCDNST
760 770 780 790 800
KGSTKKKDAV ETQVGFSWLP LLKDGRVLTS EQHIPVSANL PSGYLGYQEL
810 820 830 840 850
GMGRHYGPEV KWVEGGKPLL KISTHLVSTV YTQDQHLHNF FQYCQKTESG
860 870 880 890 900
AQASGSELVK YLKSLHAMEG HVMIAFLPTI LNQLFRVLTR ATQEEVAVNV
910 920 930 940 950
TRVIIHVVAQ CHEEGLESHL RSYVKFAYKA EPYVASEYKT VHEELTKSMT
960 970 980 990 1000
TILKPSADFL TSNKLLKYSW FFFDVLIKSM AQHLIENNKV KLLRNQRFPA
1010 1020 1030 1040 1050
SYHHAVETVV NMLMPHITQK FRDNPEASKN ANHSLAVFIK RCFTFMDRGF
1060 1070 1080 1090 1100
VFKQINNYIS CFAPGDPKTL FEYKFEFLRV VCNHEHYIPL NLPMPFGKGR
1110 1120 1130 1140 1150
IQRYQDLQLD YSLTDEFCRN HFLVGLLLRE VGTALQEFRE VRVIAISMLK
1160 1170 1180 1190 1200
NLLIKHSFDD RYNSRSHQAR IATLYLPLFG LLIENVQRIN VRDVSPFPVN
1210 1220 1230 1240 1250
PGSIVKDEAL AVPAGNPLMT PQKGNTLDHS LHKDLLGAIS GIASPYTAST
1260 1270 1280 1290 1300
PNINSVRNAD SRGSLISTDS GNSLPDRNPE KSNSLDKQQQ SGMLGNSVVR
1310 1320 1330 1340 1350
CDKLDQSEIK SLLMCFLYVL KSMSDDALFT YWNKASTAEL MDFFTISEVC
1360 1370 1380 1390 1400
LHQFQYMGKR YIARTGMMHA RLQQLGSLDN SVTFNHSYGH SEADVVHQSL
1410 1420 1430 1440 1450
LEANIATEVC LTALDTLSLF TLAFKNQLLA DHGHNPLMKK VFDVYLCFLQ
1460 1470 1480 1490 1500
KHQSEMALKN VFTALRSLIY KFPSAFYEGR ADMCASLCYE VLKCCNSKLS
1510 1520 1530 1540 1550
SIRTEASQLL YFLMRNNFDY TGKKSFVRTH LQVIISVSQL IADVVGIGGT
1560 1570 1580 1590 1600
RFQQSLSIIN NCANSDRIIK HTSFSSDVKD LTKRIRTVLM ATAQMKEHEN
1610 1620 1630 1640 1650
DPEMLVDLQY SLAKSYASTP ELRKTWLDSM ARIHVKNGDL SEAAMCYVHV
1660 1670 1680 1690 1700
TALVAEYLTR KGMFRQGCTA FRVITPNIDE EASMMEDVGM QDVHFNEDVL
1710 1720 1730 1740 1750
MELLEQCADG LWKAERYELI ADIYKLIIPI YEKRRDFERL AHLYDTLHRA
1760 1770 1780 1790 1800
YSKVTEVMHS GRRLLGTYFR VAFFGQAAQY QFTDSETDVE GFFEDEDGKE
1810 1820 1830 1840 1850
YIYKEPKLTP LSEISQRLLK LYSDKFGSEN VKMIQDSGKV NPKDLDSKFA
1860 1870 1880 1890 1900
YIQVTHVTPF FDEKELQERR TEFERCHNIR RFMFEMPFTQ TGKRQGGVEE
1910 1920 1930 1940 1950
QCKRRTILTA IHCFPYVKKR IPVMYQHHTD LNPIEVAIDE MSKKVAELRQ
1960 1970 1980 1990 2000
LCSSAEVDMI KLQLKLQGSV SVQVNAGPLA YARAFLDDTN TKRYPDNKVK
2010 2020 2030 2040 2050
LLKEVFRQFV EACGQALAVN ERLIKEDQLE YQEEMKANYR EMAKELSDIM

REQMG
Length:2,055
Mass (Da):235,312
Last modified:July 3, 2003 - v2
Checksum:iD2AC9C53F6177A66
GO
Isoform 2 (identifier: Q8BIK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1364-1364: R → RNQEGLGPIGHDRKSQTLPVSRNR
     1661-1661: K → KEADLALQREPPAFPYSHSTCQRKSWG
     1777-1790: Missing.
     2054-2055: MG → ICPLEEKTSVLPNSLHIFNAISGTPTSTVVQGLTSSSSVV

Note: No experimental confirmation available.
Show »
Length:2,128
Mass (Da):243,134
Checksum:i6BA323B84AF833D9
GO
Isoform 3 (identifier: Q8BIK4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1366: Missing.

Note: No experimental confirmation available.
Show »
Length:689
Mass (Da):79,486
Checksum:i958202C93EBC520C
GO

Sequence cautioni

The sequence AAH09134 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC65713 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti441A → T in AAH46250 (PubMed:15489334).Curated1
Sequence conflicti1288Missing in AAH46250 (PubMed:15489334).Curated1
Sequence conflicti1602P → R in BAC65713 (PubMed:12693553).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0077111 – 1366Missing in isoform 3. 1 PublicationAdd BLAST1366
Alternative sequenceiVSP_0077121364R → RNQEGLGPIGHDRKSQTLPV SRNR in isoform 2. 1 Publication1
Alternative sequenceiVSP_0077131661K → KEADLALQREPPAFPYSHST CQRKSWG in isoform 2. 1 Publication1
Alternative sequenceiVSP_0077141777 – 1790Missing in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0077152054 – 2055MG → ICPLEEKTSVLPNSLHIFNA ISGTPTSTVVQGLTSSSSVV in isoform 2. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122431 mRNA Translation: BAC65713.1 Different initiation.
AK045750 mRNA Translation: BAC32480.1
BC009134 mRNA Translation: AAH09134.1 Different initiation.
BC046250 mRNA Translation: AAH46250.1
UniGeneiMm.378591
Mm.441054

Genome annotation databases

UCSCiuc007val.1 mouse [Q8BIK4-3]
uc011zqg.1 mouse [Q8BIK4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Entry informationi

Entry nameiDOCK9_MOUSE
AccessioniPrimary (citable) accession number: Q8BIK4
Secondary accession number(s): Q921Y6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: July 3, 2003
Last modified: March 28, 2018
This is version 128 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health