Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dedicator of cytokinesis protein 9

Gene

Dock9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide-exchange factor (GEF) that activates CDC42 by exchanging bound GDP for free GTP. Overexpression induces filopodia formation (By similarity).By similarity

GO - Molecular functioni

  • Rho GTPase binding Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Dedicator of cytokinesis protein 9
Alternative name(s):
Cdc42 guanine nucleotide exchange factor zizimin-1
Gene namesi
Name:Dock9
Synonyms:D14Wsu89e, Kiaa1058
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:106321. Dock9.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 20552055Dedicator of cytokinesis protein 9PRO_0000190000Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei178 – 1781PhosphoserineCombined sources
Modified residuei181 – 1811PhosphoserineCombined sources
Modified residuei444 – 4441PhosphoserineCombined sources
Modified residuei453 – 4531PhosphoserineCombined sources
Modified residuei1244 – 12441PhosphoserineBy similarity
Modified residuei1250 – 12501PhosphothreonineBy similarity
Modified residuei1270 – 12701PhosphoserineCombined sources
Modified residuei1273 – 12731PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8BIK4.
MaxQBiQ8BIK4.
PaxDbiQ8BIK4.
PRIDEiQ8BIK4.

PTM databases

iPTMnetiQ8BIK4.
PhosphoSiteiQ8BIK4.

Expressioni

Gene expression databases

CleanExiMM_DOCK9.

Interactioni

Subunit structurei

Homodimer. Interacts preferentially with nucleotide-depleted CDC42 (By similarity).By similarity

GO - Molecular functioni

  • Rho GTPase binding Source: MGI

Protein-protein interaction databases

MINTiMINT-4997643.
STRINGi10090.ENSMUSP00000047881.

Structurei

3D structure databases

ProteinModelPortaliQ8BIK4.
SMRiQ8BIK4. Positions 182-318, 1618-2054.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini185 – 292108PHPROSITE-ProRule annotationAdd
BLAST
Domaini649 – 827179DHR-1PROSITE-ProRule annotationAdd
BLAST
Domaini1614 – 2055442DHR-2PROSITE-ProRule annotationAdd
BLAST

Domaini

The DHR-2 domain is necessary and sufficient for the GEF activity.By similarity

Sequence similaritiesi

Belongs to the DOCK family.PROSITE-ProRule annotation
Contains 1 DHR-1 domain.PROSITE-ProRule annotation
Contains 1 DHR-2 domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1997. Eukaryota.
ENOG410XNVY. LUCA.
HOGENOMiHOG000231373.
HOVERGENiHBG107819.
InParanoidiQ8BIK4.
PhylomeDBiQ8BIK4.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR027007. DHR-1_domain.
IPR027357. DHR-2.
IPR026791. DOCK.
IPR026796. DOCK9.
IPR010703. DOCK_C.
IPR021816. DOCK_C/D_N.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR23317. PTHR23317. 2 hits.
PTHR23317:SF77. PTHR23317:SF77. 2 hits.
PfamiPF06920. DHR-2. 1 hit.
PF14429. DOCK-C2. 1 hit.
PF11878. DUF3398. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 4 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS51650. DHR_1. 1 hit.
PS51651. DHR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BIK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCTTSVILF KGIRTVFERN CAYMCKQPGE SNALEYTAYN WSKEDSELSI
60 70 80 90 100
AFCLAKPKLI EPLDYENVIV QKKTQILNDC LREMLLFPYD DFQTAILRRQ
110 120 130 140 150
GRYLRSTVPA NAEEEAQSLF VTECIKTYNS DWHLVTYKYE DYSGEFRQLP
160 170 180 190 200
NKVPKLDKLP VHVYEVDEEA DKDEDAASLG SQKGGITKHG WLYKGNMNSA
210 220 230 240 250
ISVTMRSFKR RFFHLIQLGD GSYNLNFYKD EKISKEPKGS IFLDSCMGVI
260 270 280 290 300
QNNRVRRFAF ELKMQDKSSY LLAADSEAEM EEWVTVLNKI LQLNFEAAMQ
310 320 330 340 350
EKRNGDPHED DEQSKLEGSG SGLDSYLPEL AKSTREAEIK LKSESRVKLF
360 370 380 390 400
YLDPDTQKLD FSSAEPEVKP FEEKFGKRIL VKCNDLSFNL QCCVAENEEG
410 420 430 440 450
PTTNVEPFFV TLSLFDIKYN RKISADFHVD LNHFSVRQML APTSPALMNG
460 470 480 490 500
GQSPPAFQDA LHTAMQYPKQ GIFSVTCPHP DIFLVARIEK VLQGSITHCA
510 520 530 540 550
EPYMRSSDSS KVAQKVLKNA KQACQRLGQY RMPFAWAART LFKDTSGNLD
560 570 580 590 600
KNARFSAIYR QDSNKLSNDD MLKLLADFRK PEKMAKLPVI LGNLDITIDS
610 620 630 640 650
VSCDFPNYLN SSYIPMRQFE TCSKSPITFE VEEFVPCIPK HTQPYTVYSN
660 670 680 690 700
HLYVYPKYLK YDSQKSFAKA RNIAICIEFK DSDEEDSQPL KCIYGRPGGP
710 720 730 740 750
VFTRSALAAV LHHQQNPEFY DEIKIELPAQ LHERHHLLFT FFHVSCDNST
760 770 780 790 800
KGSTKKKDAV ETQVGFSWLP LLKDGRVLTS EQHIPVSANL PSGYLGYQEL
810 820 830 840 850
GMGRHYGPEV KWVEGGKPLL KISTHLVSTV YTQDQHLHNF FQYCQKTESG
860 870 880 890 900
AQASGSELVK YLKSLHAMEG HVMIAFLPTI LNQLFRVLTR ATQEEVAVNV
910 920 930 940 950
TRVIIHVVAQ CHEEGLESHL RSYVKFAYKA EPYVASEYKT VHEELTKSMT
960 970 980 990 1000
TILKPSADFL TSNKLLKYSW FFFDVLIKSM AQHLIENNKV KLLRNQRFPA
1010 1020 1030 1040 1050
SYHHAVETVV NMLMPHITQK FRDNPEASKN ANHSLAVFIK RCFTFMDRGF
1060 1070 1080 1090 1100
VFKQINNYIS CFAPGDPKTL FEYKFEFLRV VCNHEHYIPL NLPMPFGKGR
1110 1120 1130 1140 1150
IQRYQDLQLD YSLTDEFCRN HFLVGLLLRE VGTALQEFRE VRVIAISMLK
1160 1170 1180 1190 1200
NLLIKHSFDD RYNSRSHQAR IATLYLPLFG LLIENVQRIN VRDVSPFPVN
1210 1220 1230 1240 1250
PGSIVKDEAL AVPAGNPLMT PQKGNTLDHS LHKDLLGAIS GIASPYTAST
1260 1270 1280 1290 1300
PNINSVRNAD SRGSLISTDS GNSLPDRNPE KSNSLDKQQQ SGMLGNSVVR
1310 1320 1330 1340 1350
CDKLDQSEIK SLLMCFLYVL KSMSDDALFT YWNKASTAEL MDFFTISEVC
1360 1370 1380 1390 1400
LHQFQYMGKR YIARTGMMHA RLQQLGSLDN SVTFNHSYGH SEADVVHQSL
1410 1420 1430 1440 1450
LEANIATEVC LTALDTLSLF TLAFKNQLLA DHGHNPLMKK VFDVYLCFLQ
1460 1470 1480 1490 1500
KHQSEMALKN VFTALRSLIY KFPSAFYEGR ADMCASLCYE VLKCCNSKLS
1510 1520 1530 1540 1550
SIRTEASQLL YFLMRNNFDY TGKKSFVRTH LQVIISVSQL IADVVGIGGT
1560 1570 1580 1590 1600
RFQQSLSIIN NCANSDRIIK HTSFSSDVKD LTKRIRTVLM ATAQMKEHEN
1610 1620 1630 1640 1650
DPEMLVDLQY SLAKSYASTP ELRKTWLDSM ARIHVKNGDL SEAAMCYVHV
1660 1670 1680 1690 1700
TALVAEYLTR KGMFRQGCTA FRVITPNIDE EASMMEDVGM QDVHFNEDVL
1710 1720 1730 1740 1750
MELLEQCADG LWKAERYELI ADIYKLIIPI YEKRRDFERL AHLYDTLHRA
1760 1770 1780 1790 1800
YSKVTEVMHS GRRLLGTYFR VAFFGQAAQY QFTDSETDVE GFFEDEDGKE
1810 1820 1830 1840 1850
YIYKEPKLTP LSEISQRLLK LYSDKFGSEN VKMIQDSGKV NPKDLDSKFA
1860 1870 1880 1890 1900
YIQVTHVTPF FDEKELQERR TEFERCHNIR RFMFEMPFTQ TGKRQGGVEE
1910 1920 1930 1940 1950
QCKRRTILTA IHCFPYVKKR IPVMYQHHTD LNPIEVAIDE MSKKVAELRQ
1960 1970 1980 1990 2000
LCSSAEVDMI KLQLKLQGSV SVQVNAGPLA YARAFLDDTN TKRYPDNKVK
2010 2020 2030 2040 2050
LLKEVFRQFV EACGQALAVN ERLIKEDQLE YQEEMKANYR EMAKELSDIM

REQMG
Length:2,055
Mass (Da):235,312
Last modified:July 3, 2003 - v2
Checksum:iD2AC9C53F6177A66
GO
Isoform 2 (identifier: Q8BIK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1364-1364: R → RNQEGLGPIGHDRKSQTLPVSRNR
     1661-1661: K → KEADLALQREPPAFPYSHSTCQRKSWG
     1777-1790: Missing.
     2054-2055: MG → ICPLEEKTSVLPNSLHIFNAISGTPTSTVVQGLTSSSSVV

Note: No experimental confirmation available.
Show »
Length:2,128
Mass (Da):243,134
Checksum:i6BA323B84AF833D9
GO
Isoform 3 (identifier: Q8BIK4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1366: Missing.

Note: No experimental confirmation available.
Show »
Length:689
Mass (Da):79,486
Checksum:i958202C93EBC520C
GO

Sequence cautioni

The sequence AAH09134.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC65713.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti441 – 4411A → T in AAH46250 (PubMed:15489334).Curated
Sequence conflicti1288 – 12881Missing in AAH46250 (PubMed:15489334).Curated
Sequence conflicti1602 – 16021P → R in BAC65713 (PubMed:12693553).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 13661366Missing in isoform 3. 1 PublicationVSP_007711Add
BLAST
Alternative sequencei1364 – 13641R → RNQEGLGPIGHDRKSQTLPV SRNR in isoform 2. 1 PublicationVSP_007712
Alternative sequencei1661 – 16611K → KEADLALQREPPAFPYSHST CQRKSWG in isoform 2. 1 PublicationVSP_007713
Alternative sequencei1777 – 179014Missing in isoform 2. 1 PublicationVSP_007714Add
BLAST
Alternative sequencei2054 – 20552MG → ICPLEEKTSVLPNSLHIFNA ISGTPTSTVVQGLTSSSSVV in isoform 2. 1 PublicationVSP_007715

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122431 mRNA. Translation: BAC65713.1. Different initiation.
AK045750 mRNA. Translation: BAC32480.1.
BC009134 mRNA. Translation: AAH09134.1. Different initiation.
BC046250 mRNA. Translation: AAH46250.1.
UniGeneiMm.441054.

Genome annotation databases

UCSCiuc007val.1. mouse. [Q8BIK4-3]
uc011zqg.1. mouse. [Q8BIK4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122431 mRNA. Translation: BAC65713.1. Different initiation.
AK045750 mRNA. Translation: BAC32480.1.
BC009134 mRNA. Translation: AAH09134.1. Different initiation.
BC046250 mRNA. Translation: AAH46250.1.
UniGeneiMm.441054.

3D structure databases

ProteinModelPortaliQ8BIK4.
SMRiQ8BIK4. Positions 182-318, 1618-2054.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-4997643.
STRINGi10090.ENSMUSP00000047881.

PTM databases

iPTMnetiQ8BIK4.
PhosphoSiteiQ8BIK4.

Proteomic databases

EPDiQ8BIK4.
MaxQBiQ8BIK4.
PaxDbiQ8BIK4.
PRIDEiQ8BIK4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc007val.1. mouse. [Q8BIK4-3]
uc011zqg.1. mouse. [Q8BIK4-1]

Organism-specific databases

MGIiMGI:106321. Dock9.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1997. Eukaryota.
ENOG410XNVY. LUCA.
HOGENOMiHOG000231373.
HOVERGENiHBG107819.
InParanoidiQ8BIK4.
PhylomeDBiQ8BIK4.

Miscellaneous databases

ChiTaRSiDock9. mouse.
PROiQ8BIK4.
SOURCEiSearch...

Gene expression databases

CleanExiMM_DOCK9.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR027007. DHR-1_domain.
IPR027357. DHR-2.
IPR026791. DOCK.
IPR026796. DOCK9.
IPR010703. DOCK_C.
IPR021816. DOCK_C/D_N.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR23317. PTHR23317. 2 hits.
PTHR23317:SF77. PTHR23317:SF77. 2 hits.
PfamiPF06920. DHR-2. 1 hit.
PF14429. DOCK-C2. 1 hit.
PF11878. DUF3398. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 4 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS51650. DHR_1. 1 hit.
PS51651. DHR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 212-2055 (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-178; SER-181; SER-444; SER-453; SER-1270 AND SER-1273, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiDOCK9_MOUSE
AccessioniPrimary (citable) accession number: Q8BIK4
Secondary accession number(s): Q921Y6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: July 3, 2003
Last modified: June 8, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

'Zizim' means 'spike' in Hebrew.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.