Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FERM domain-containing protein 4A

Gene

Frmd4a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • protein binding, bridging Source: MGI

GO - Biological processi

  • establishment of epithelial cell polarity Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
FERM domain-containing protein 4A
Gene namesi
Name:Frmd4a
Synonyms:Frmd4, Kiaa1294
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1919850. Frmd4a.

Subcellular locationi

GO - Cellular componenti

  • bicellular tight junction Source: MGI
  • cytoplasm Source: UniProtKB-KW
  • cytoskeleton Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002194451 – 1020FERM domain-containing protein 4AAdd BLAST1020

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei515PhosphoserineBy similarity1
Modified residuei590PhosphoserineBy similarity1
Modified residuei601PhosphoserineCombined sources1
Modified residuei666PhosphoserineBy similarity1
Modified residuei696PhosphoserineCombined sources1
Modified residuei785PhosphoserineBy similarity1
Modified residuei854PhosphoserineBy similarity1
Modified residuei882PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BIE6.
PRIDEiQ8BIE6.

PTM databases

iPTMnetiQ8BIE6.
PhosphoSitePlusiQ8BIE6.

Expressioni

Gene expression databases

BgeeiENSMUSG00000026657.
CleanExiMM_FRMD4A.
ExpressionAtlasiQ8BIE6. baseline and differential.
GenevisibleiQ8BIE6. MM.

Interactioni

GO - Molecular functioni

  • protein binding, bridging Source: MGI

Protein-protein interaction databases

BioGridi229099. 1 interactor.
STRINGi10090.ENSMUSP00000089079.

Structurei

3D structure databases

ProteinModelPortaliQ8BIE6.
SMRiQ8BIE6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 307FERMPROSITE-ProRule annotationAdd BLAST303

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili367 – 401Sequence analysisAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi613 – 741Ser-richAdd BLAST129
Compositional biasi916 – 988Ser-richAdd BLAST73

Sequence similaritiesi

Contains 1 FERM domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3529. Eukaryota.
ENOG410XQFP. LUCA.
GeneTreeiENSGT00860000133727.
HOGENOMiHOG000294161.
HOVERGENiHBG062800.
InParanoidiQ8BIE6.
OMAiKEYPLYV.
OrthoDBiEOG091G0B4Y.
PhylomeDBiQ8BIE6.
TreeFamiTF328984.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR019749. Band_41_domain.
IPR021774. DUF3338.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_dom-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF11819. DUF3338. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
SMARTiSM00295. B41. 1 hit.
SM01196. FERM_C. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS00661. FERM_2. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BIE6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTEGRRCQVH LLDDRKLELL VQPKLLAKEL LDLVASHFNL KEKEYFGIAF
60 70 80 90 100
TDETGHLNWL QLDRRVLEHD FPKKSGPVVL YFCVRFYIES ISYLKDNATI
110 120 130 140 150
ELFFLNAKSC IYKELIDVDS EVVFELASYI LQEAKGDFSS NEVVRSDLKK
160 170 180 190 200
LPALPTQALK EHPSLAYCED RVIEYYKKLN GQTRGQAIVN YMSIVESLPT
210 220 230 240 250
YGVHYYAVKD KQGIPWWLGL SYKGIFQYDY HDKVKPRKIF QWRQLENLYF
260 270 280 290 300
REKKFSVEVH DPRRASVTRR TFGHSGIAVH TWYACPALIK SIWAMAISQH
310 320 330 340 350
QFYLDRKQSK SKIHAARSLS EIAIDLTETG TLKTSKLANM GSKGKIISGS
360 370 380 390 400
SGSLLSSGSQ ESDSSQSAKK DMLAALKSRQ EALEETLRQR LEELKRLCLR
410 420 430 440 450
EAELTGKLPV EYPLDPGEEP PIVRRRIGTA FKLDEQKILP KGEEAELERL
460 470 480 490 500
EREFAIQSQI TEAARRLASD PNVSKKLKKQ RKTSYLNALK KLQEIENAIN
510 520 530 540 550
ENRIKSGKKP TQRASLVIDD GNIASEDSSL SDALVLEDED SQVTSTISPL
560 570 580 590 600
QSPHKGLPPR PPSSHNRPPP PQSLEGLRQL HYHRTDYDKS PLKPKMWSES
610 620 630 640 650
SLDEPYEKVK KRSSHGHSSS HKRFPSTGSC TEAGVSSSLQ NSPIRSLPHW
660 670 680 690 700
NSQSSMPSTP DLRVRSPHYV HSTRSVDISP TRLHSLALHF RHRSSSLESQ
710 720 730 740 750
GKLLGSENDT GSPDFYTPRT RSSNGSDPMD DCSSCTSHSS SEHYYPAQMN
760 770 780 790 800
ANYSTLAEDS PSKARQRQRQ RQRAAGALGS ASSGSMPNLA ARSGAASTGG
810 820 830 840 850
GVYLHSQSQP SSQYRIKEYP LYIEGSATPV VVRSLESDQE GHYSVKAQFK
860 870 880 890 900
TSNSYTAGGL FKESWRGGGD EGDAGRLTPS RSQILRTPSL GRDGAHDKGS
910 920 930 940 950
GRAAVSDELR QWYQRSTASH KEHSRLSHTS STSSDSGSQY STSSQSTFVA
960 970 980 990 1000
HSRVTRMPQM CKATSAALPQ SQRSSTPSSE IGATPPSSPH HILTWQTGEA
1010 1020
TENSPIMDGS ESPTHQSTDE
Length:1,020
Mass (Da):113,879
Last modified:June 27, 2006 - v2
Checksum:i68E4E578FB91BF45
GO
Isoform 2 (identifier: Q8BIE6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGLLSPMRTKM
     999-1020: EATENSPIMDGSESPTHQSTDE → SYSDSCFLDSSLYPELADVQWYGQEKAKPGTLV

Note: No experimental confirmation available.
Show »
Length:1,042
Mass (Da):116,460
Checksum:i990CDB8DACA4B3D2
GO

Sequence cautioni

The sequence AAH58672 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAM46015 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAM46271 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti758E → G in BAC38478 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0353781M → MEGLLSPMRTKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_019592999 – 1020EATEN…QSTDE → SYSDSCFLDSSLYPELADVQ WYGQEKAKPGTLV in isoform 2. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK082365 mRNA. Translation: BAC38478.1.
AL807832, AL928947 Genomic DNA. Translation: CAM46014.1.
AL807832, AL928947 Genomic DNA. Translation: CAM46015.1. Sequence problems.
AL928947, AL807832 Genomic DNA. Translation: CAM46270.1.
AL928947, AL807832 Genomic DNA. Translation: CAM46271.1. Sequence problems.
BC058672 mRNA. Translation: AAH58672.1. Different initiation.
AB093292 mRNA. Translation: BAC41475.1.
CCDSiCCDS15656.2. [Q8BIE6-2]
CCDS50488.1. [Q8BIE6-1]
RefSeqiNP_001171314.1. NM_001177843.1. [Q8BIE6-1]
NP_766063.3. NM_172475.3. [Q8BIE6-2]
XP_006497503.1. XM_006497440.1.
XP_006497504.1. XM_006497441.1.
XP_006497505.1. XM_006497442.2.
UniGeneiMm.37932.
Mm.396281.
Mm.487653.

Genome annotation databases

EnsembliENSMUST00000075767; ENSMUSP00000075172; ENSMUSG00000026657. [Q8BIE6-1]
ENSMUST00000091497; ENSMUSP00000089079; ENSMUSG00000026657. [Q8BIE6-2]
GeneIDi209630.
KEGGimmu:209630.
UCSCiuc008ieo.2. mouse. [Q8BIE6-2]
uc008ies.2. mouse. [Q8BIE6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK082365 mRNA. Translation: BAC38478.1.
AL807832, AL928947 Genomic DNA. Translation: CAM46014.1.
AL807832, AL928947 Genomic DNA. Translation: CAM46015.1. Sequence problems.
AL928947, AL807832 Genomic DNA. Translation: CAM46270.1.
AL928947, AL807832 Genomic DNA. Translation: CAM46271.1. Sequence problems.
BC058672 mRNA. Translation: AAH58672.1. Different initiation.
AB093292 mRNA. Translation: BAC41475.1.
CCDSiCCDS15656.2. [Q8BIE6-2]
CCDS50488.1. [Q8BIE6-1]
RefSeqiNP_001171314.1. NM_001177843.1. [Q8BIE6-1]
NP_766063.3. NM_172475.3. [Q8BIE6-2]
XP_006497503.1. XM_006497440.1.
XP_006497504.1. XM_006497441.1.
XP_006497505.1. XM_006497442.2.
UniGeneiMm.37932.
Mm.396281.
Mm.487653.

3D structure databases

ProteinModelPortaliQ8BIE6.
SMRiQ8BIE6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229099. 1 interactor.
STRINGi10090.ENSMUSP00000089079.

PTM databases

iPTMnetiQ8BIE6.
PhosphoSitePlusiQ8BIE6.

Proteomic databases

PaxDbiQ8BIE6.
PRIDEiQ8BIE6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075767; ENSMUSP00000075172; ENSMUSG00000026657. [Q8BIE6-1]
ENSMUST00000091497; ENSMUSP00000089079; ENSMUSG00000026657. [Q8BIE6-2]
GeneIDi209630.
KEGGimmu:209630.
UCSCiuc008ieo.2. mouse. [Q8BIE6-2]
uc008ies.2. mouse. [Q8BIE6-1]

Organism-specific databases

CTDi55691.
MGIiMGI:1919850. Frmd4a.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3529. Eukaryota.
ENOG410XQFP. LUCA.
GeneTreeiENSGT00860000133727.
HOGENOMiHOG000294161.
HOVERGENiHBG062800.
InParanoidiQ8BIE6.
OMAiKEYPLYV.
OrthoDBiEOG091G0B4Y.
PhylomeDBiQ8BIE6.
TreeFamiTF328984.

Miscellaneous databases

PROiQ8BIE6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026657.
CleanExiMM_FRMD4A.
ExpressionAtlasiQ8BIE6. baseline and differential.
GenevisibleiQ8BIE6. MM.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR019749. Band_41_domain.
IPR021774. DUF3338.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_dom-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF11819. DUF3338. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
SMARTiSM00295. B41. 1 hit.
SM01196. FERM_C. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS00661. FERM_2. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFRM4A_MOUSE
AccessioniPrimary (citable) accession number: Q8BIE6
Secondary accession number(s): B1AXK1
, B1AXK2, Q6PDJ4, Q8CHA6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: June 27, 2006
Last modified: November 30, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.