Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Melanoma inhibitory activity protein 3

Gene

Mia3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the transport of cargos that are too large to fit into COPII-coated vesicles and require specific mechanisms to be incorporated into membrane-bound carriers and exported from the endoplasmic reticulum. This protein is required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. It may participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. It is also specifically required for the secretion of lipoproteins by participating in their export from the endoplasmic reticulum.By similarity

GO - Molecular functioni

GO - Biological processi

  • cargo loading into COPII-coated vesicle Source: UniProtKB
  • chondrocyte development Source: MGI
  • collagen fibril organization Source: MGI
  • ER to Golgi vesicle-mediated transport Source: UniProtKB
  • exocytosis Source: UniProtKB
  • lipoprotein transport Source: UniProtKB
  • negative regulation of cell adhesion Source: MGI
  • negative regulation of cell migration Source: MGI
  • positive regulation of bone mineralization Source: MGI
  • positive regulation of leukocyte migration Source: MGI
  • protein transport Source: UniProtKB
  • wound healing Source: MGI
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Exocytosis, Protein transport, Transport

Protein family/group databases

TCDBi9.B.113.1.1. the collagen secretory protein, mia3 (mia3) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Melanoma inhibitory activity protein 3
Alternative name(s):
Transport and Golgi organization protein 1
Gene namesi
Name:Mia3
Synonyms:Kiaa0268, Tango1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2443183. Mia3.

Subcellular locationi

  • Endoplasmic reticulum membrane By similarity; Single-pass membrane protein By similarity

  • Note: Localizes at endoplasmic reticulum exit sites. After loading of COL7A1 into transport carriers, it is not incorporated into COPII carriers and remains in the endoplasmic reticulum membrane.By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini25 – 1171LumenalSequence analysisAdd BLAST1147
Intramembranei1172 – 1192Sequence analysisAdd BLAST21
Topological domaini1193 – 1202LumenalSequence analysis10
Transmembranei1203 – 1223HelicalSequence analysisAdd BLAST21
Topological domaini1224 – 1930CytoplasmicSequence analysisAdd BLAST707

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000028899925 – 1930Melanoma inhibitory activity protein 3Add BLAST1906

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei229PhosphoserineBy similarity1
Glycosylationi360N-linked (GlcNAc...)Sequence analysis1
Glycosylationi631N-linked (GlcNAc...)Sequence analysis1
Modified residuei856PhosphoserineBy similarity1
Modified residuei1458PhosphoserineCombined sources1
Modified residuei1693PhosphoserineCombined sources1
Modified residuei1705PhosphoserineCombined sources1
Modified residuei1733PhosphoserineBy similarity1
Modified residuei1754PhosphoserineCombined sources1
Modified residuei1766PhosphoserineCombined sources1
Modified residuei1770PhosphoserineBy similarity1
Modified residuei1805Asymmetric dimethylarginineCombined sources1
Modified residuei1915PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Methylation, Phosphoprotein

Proteomic databases

EPDiQ8BI84.
PaxDbiQ8BI84.
PeptideAtlasiQ8BI84.
PRIDEiQ8BI84.

PTM databases

iPTMnetiQ8BI84.
PhosphoSitePlusiQ8BI84.

Expressioni

Developmental stagei

Ubiquitously expressed during embryogenesis, starting at E8.1 Publication

Gene expression databases

CleanExiMM_MIA3.

Interactioni

Subunit structurei

Interacts (via SH3 domain) with COL7A1. Interacts with the COPII coat subunits SEC23A and SEC24C. Interacts with CTAGE5. May interact with APOB and MIA2.By similarity

Protein-protein interaction databases

IntActiQ8BI84. 2 interactors.
MINTiMINT-4110703.
STRINGi10090.ENSMUSP00000064801.

Structurei

3D structure databases

ProteinModelPortaliQ8BI84.
SMRiQ8BI84.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 107SH3Add BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1238 – 1677Mediates interaction with CTAGE5By similarityAdd BLAST440
Regioni1776 – 1930Proline-rich domain (PRD); probably mediates interaction with COPII coat subunitsBy similarityAdd BLAST155

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1236 – 1329Sequence analysisAdd BLAST94
Coiled coili1359 – 1422Sequence analysisAdd BLAST64
Coiled coili1514 – 1662Sequence analysisAdd BLAST149

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi317 – 324Poly-Glu8
Compositional biasi693 – 699Poly-Glu7
Compositional biasi1020 – 1110Pro-richAdd BLAST91
Compositional biasi1667 – 1916Pro-richAdd BLAST250

Domaini

The proline-rich domain (PRD) mediates the interaction with COPII coat subunits.By similarity
Although 2 transmembrane domains are predicted, it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region.By similarity

Sequence similaritiesi

Belongs to the MIA/OTOR family. Tango1 subfamily.Curated
Contains 1 SH3 domain.Curated

Keywords - Domaini

Coiled coil, SH3 domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IFUG. Eukaryota.
ENOG410YVAS. LUCA.
HOVERGENiHBG108133.
InParanoidiQ8BI84.
PhylomeDBiQ8BI84.

Family and domain databases

InterProiIPR029781. MIA3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23158:SF37. PTHR23158:SF37. 1 hit.
PfamiPF07653. SH3_2. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BI84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAPGLLFW LFVLGALWWV PGQSDLSHGR RFSDLKVCGD EECSMLMYRG
60 70 80 90 100
KALEDFTGPD CRFVNFKKGD DVYVYYKLAG GSLELWAGSV EHSFGYFPKD
110 120 130 140 150
LIKVLHKYTE EELHIPADET DFVCFEGGRD DFNSYNVEEL LGSLELEDSV
160 170 180 190 200
PEESKKAEEV SQHREKSPEE SRGRELDPVP EPEAFRADSE DGEGAFSEST
210 220 230 240 250
EGLQGQPSAQ ESHPHTSGPA ANAQGVQSSL DTFEEILHDK LKVPGSESRT
260 270 280 290 300
GNSSPASVER EKTDAYKVLK TEMSLDLKTK FGSTADALVS DDEATRLVTS
310 320 330 340 350
LEDGFDEALD AEYYPMEEEE EVEEDADSSD ELPLLTFSDK DEKVPGKPMI
360 370 380 390 400
EKYLTDKDPN LSEEDKVEPP TWGDAFFSIV TGGEGKPGVV DLERSIEEEE
410 420 430 440 450
DVSVSSSHQR KPQPAAGYTD SEDEGDDLFV EEPKTNDVKD SETDPELVIT
460 470 480 490 500
GEEKDIQESR KGLVQPESQS EDAKSETASA YRLQGSKLNP LSAAEKGRDF
510 520 530 540 550
TLKAVFEKKE NGLKESVIHI SKETLHEDKT REIQRDSLES ELVHRALGSS
560 570 580 590 600
VTENNKPKSL GVAPLLGNNK PDASKDSTEV PDGSVSGPKA GQQEGFLEPG
610 620 630 640 650
LKTQHQPRFS PPEETGPSRE LGGKVPISGR NLSWQQEQDV AAVVGKHANE
660 670 680 690 700
KTGFPEEESR EDGTDAEQAR AIRRPQEAES PEVLSVQPGR PDEEEEEEEG
710 720 730 740 750
DNYPPEGLME DENAVSAQQS RENSPSARDG RSDMNSQVFE KVILGTLNLN
760 770 780 790 800
TEKTKQPANM ILETGQESET TSEEAGDVGK ESGHSVVVDS EESHLADMRA
810 820 830 840 850
QRPSQVHGLR DETAAQTPGS GEAVLSKNPN DLQKDNPEEE LVNTLGLEDP
860 870 880 890 900
GVGEISEGEP EDTKEFGVSE SQGTDAEDLR DDPSRQATPE IPDIVLKSIR
910 920 930 940 950
EDLPIINSFF KDDQQSLHRF LKYFDVRELE GLLEDMSIRL RSAHQNSLPY
960 970 980 990 1000
NMEKVLDKVF RASESRILSM AEKMLDTGVA KNRDLGSKES SPLEEAEVLD
1010 1020 1030 1040 1050
DIQDLIYFVR YQYSGVETAP LVTPPPPEEG WARPGEERQP PQQDSLPQEN
1060 1070 1080 1090 1100
TGDLSVQPPE EPELSDQPVT SVQPPEEPEL SDQPVTSVQP PEEPELSDQP
1110 1120 1130 1140 1150
VTSVQPPEEP ELSDQPVTGY TSTSEVSQKP DTKKDIDLGP VMEGGPVGAG
1160 1170 1180 1190 1200
DVQKQLETIA EEPAAVPPLE SAFGSLYAFI LYLSKMLLAT LPDNVQPGPD
1210 1220 1230 1240 1250
FYGLPWQPVI ITAVLGIVSF AIFSWRTILV VKSRVYQVTE KQISEKLENI
1260 1270 1280 1290 1300
KKENAELMQK LSSYEQKIKE SKKYVQETKK QNMILSDEAV KYKDKIKILE
1310 1320 1330 1340 1350
ETNVSLGDKA KSLRLQLESE REQNVKNQDL ILENKKSIEK LKDVISMNAS
1360 1370 1380 1390 1400
ELSEVQVALN EAKLSEENVK SECHRVQEEN ARLKKKKEQL QQQVEEWSKS
1410 1420 1430 1440 1450
HAELTGQIKS FEKSQEDLEI ALTHKDDNIS ALTNCITQLN RLECELESED
1460 1470 1480 1490 1500
PDKGGNESDD LANGETGGDR SEKIRNRIKQ MMDVSRTQTA VSIVEEDLKL
1510 1520 1530 1540 1550
LQLKLRASMS TKCNLEDQIK KLEDDRSSLQ TAKAGLEDEC KTLRQKVEIL
1560 1570 1580 1590 1600
NELYQQKEMA LQKKLSQEEY ERQDREQRLT AADEKVVLAA EEVKTYKRRI
1610 1620 1630 1640 1650
EEMEEELQKT ERSFKNQIAA HEKKAHDNWL KARAAERAMA EEKREAANLR
1660 1670 1680 1690 1700
HKLLEMTQKM AMRQDEPVIV KPMPGRPNTQ NPPRRGLLSQ NGSFGPSPVS
1710 1720 1730 1740 1750
GGECSPPLPA EPPGRPLSAT LSRRDTPRSE FGSLDRHLPR PRWPSEASGK
1760 1770 1780 1790 1800
HSASDPGPAP VVNSSSRSSS PAKAVDEGKV NMAPKGPPPF PGVPLMGGPV
1810 1820 1830 1840 1850
PPPIRYGPPP QLCGGPFGPR PLPPPFVPGM HPPLGVREYA PGVLPGKRDL
1860 1870 1880 1890 1900
PLDPREFLPG HTPFRPPGSL GPREFFIPGT RLPPPTHGPQ EYPPPPPAVR
1910 1920 1930
DSLPSGPREE AKPASPSSVQ DRSQASKPTP
Length:1,930
Mass (Da):213,675
Last modified:May 29, 2007 - v2
Checksum:i7C80FC1260136D7F
GO
Isoform 2 (identifier: Q8BI84-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1232-1239: KSRVYQVT → SKLNYLIT
     1240-1930: Missing.

Note: No experimental confirmation available.
Show »
Length:1,239
Mass (Da):136,350
Checksum:i6E16F9D42ECEFF05
GO
Isoform 3 (identifier: Q8BI84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1149: Missing.
     1150-1186: GDVQKQLETIAEEPAAVPPLESAFGSLYAFILYLSKM → MDSLPATVPAVTASPGDPELLGPLSVLYAALIAKLLE

Show »
Length:781
Mass (Da):86,913
Checksum:iC826E08DDB24AD20
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0258651 – 1149Missing in isoform 3. 1 PublicationAdd BLAST1149
Alternative sequenceiVSP_0258661150 – 1186GDVQK…YLSKM → MDSLPATVPAVTASPGDPEL LGPLSVLYAALIAKLLE in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0258671232 – 1239KSRVYQVT → SKLNYLIT in isoform 2. 1 Publication8
Alternative sequenceiVSP_0258681240 – 1930Missing in isoform 2. 1 PublicationAdd BLAST691

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK044749 mRNA. Translation: BAC32064.1.
AK046506 mRNA. Translation: BAC32759.1.
AK078951 mRNA. Translation: BAC37474.1.
AK084344 mRNA. Translation: BAC39164.1.
AK148470 mRNA. Translation: BAE28571.1. Different termination.
CAAA01083517 Genomic DNA. No translation available.
AK220252 mRNA. Translation: BAD90177.1.
BC125472 mRNA. Translation: AAI25473.1.
RefSeqiNP_796363.2. NM_177389.3. [Q8BI84-1]
UniGeneiMm.41152.

Genome annotation databases

GeneIDi338366.
KEGGimmu:338366.
UCSCiuc008icw.1. mouse. [Q8BI84-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK044749 mRNA. Translation: BAC32064.1.
AK046506 mRNA. Translation: BAC32759.1.
AK078951 mRNA. Translation: BAC37474.1.
AK084344 mRNA. Translation: BAC39164.1.
AK148470 mRNA. Translation: BAE28571.1. Different termination.
CAAA01083517 Genomic DNA. No translation available.
AK220252 mRNA. Translation: BAD90177.1.
BC125472 mRNA. Translation: AAI25473.1.
RefSeqiNP_796363.2. NM_177389.3. [Q8BI84-1]
UniGeneiMm.41152.

3D structure databases

ProteinModelPortaliQ8BI84.
SMRiQ8BI84.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BI84. 2 interactors.
MINTiMINT-4110703.
STRINGi10090.ENSMUSP00000064801.

Protein family/group databases

TCDBi9.B.113.1.1. the collagen secretory protein, mia3 (mia3) family.

PTM databases

iPTMnetiQ8BI84.
PhosphoSitePlusiQ8BI84.

Proteomic databases

EPDiQ8BI84.
PaxDbiQ8BI84.
PeptideAtlasiQ8BI84.
PRIDEiQ8BI84.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi338366.
KEGGimmu:338366.
UCSCiuc008icw.1. mouse. [Q8BI84-1]

Organism-specific databases

CTDi375056.
MGIiMGI:2443183. Mia3.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IFUG. Eukaryota.
ENOG410YVAS. LUCA.
HOVERGENiHBG108133.
InParanoidiQ8BI84.
PhylomeDBiQ8BI84.

Miscellaneous databases

PROiQ8BI84.
SOURCEiSearch...

Gene expression databases

CleanExiMM_MIA3.

Family and domain databases

InterProiIPR029781. MIA3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23158:SF37. PTHR23158:SF37. 1 hit.
PfamiPF07653. SH3_2. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMIA3_MOUSE
AccessioniPrimary (citable) accession number: Q8BI84
Secondary accession number(s): A0JLX8
, Q3UFI9, Q571D7, Q8BJE9, Q8BL31, Q8C5B9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: November 2, 2016
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.