Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8BHX3

- BOREA_MOUSE

UniProt

Q8BHX3 - BOREA_MOUSE

Protein

Borealin

Gene

Cdca8

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (25 Jul 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: MGI

    GO - Biological processi

    1. chromosome organization Source: Ensembl
    2. mitotic nuclear division Source: UniProtKB-KW

    Keywords - Biological processi

    Cell cycle, Cell division, Mitosis

    Enzyme and pathway databases

    ReactomeiREACT_198961. Resolution of Sister Chromatid Cohesion.
    REACT_207679. Separation of Sister Chromatids.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Borealin
    Alternative name(s):
    Cell division cycle-associated protein 8
    MESrg
    Gene namesi
    Name:Cdca8
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:1196274. Cdca8.

    Subcellular locationi

    Nucleusnucleolus By similarity. Cytoplasm By similarity. Chromosomecentromere By similarity. Cytoplasmcytoskeletonspindle By similarity
    Note: Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with SENP3 in the nucleolus in interphase cells.By similarity

    GO - Cellular componenti

    1. chromocenter Source: MGI
    2. chromosome, centromeric region Source: UniProtKB-SubCell
    3. chromosome passenger complex Source: UniProtKB
    4. half bridge of spindle pole body Source: Ensembl
    5. midbody Source: Ensembl
    6. nucleolus Source: UniProtKB-SubCell
    7. protein complex Source: UniProtKB

    Keywords - Cellular componenti

    Centromere, Chromosome, Cytoplasm, Cytoskeleton, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 289289BorealinPRO_0000247076Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei91 – 911Citrulline1 Publication
    Modified residuei94 – 941Phosphothreonine; by TTKBy similarity
    Modified residuei106 – 1061PhosphothreonineBy similarity
    Modified residuei110 – 1101PhosphoserineBy similarity
    Modified residuei175 – 1751Phosphoserine; by AURKBBy similarity
    Modified residuei198 – 1981PhosphothreonineBy similarity
    Modified residuei213 – 2131PhosphothreonineBy similarity
    Modified residuei228 – 2281PhosphoserineBy similarity
    Modified residuei233 – 2331PhosphoserineBy similarity
    Modified residuei247 – 2471PhosphoserineBy similarity
    Modified residuei253 – 2531PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylated by TTK, essentially at Thr-94.By similarity
    Sumoylated by UBE2I and RANBP2. Desumoylated by SENP3 through the removal of SUMO2 and SUMO3 By similarity.By similarity
    Citrullinated by PADI4.1 Publication

    Keywords - PTMi

    Citrullination, Phosphoprotein, Ubl conjugation

    Proteomic databases

    PRIDEiQ8BHX3.

    PTM databases

    PhosphoSiteiQ8BHX3.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8BHX3.
    BgeeiQ8BHX3.
    CleanExiMM_CDCA8.
    GenevestigatoriQ8BHX3.

    Interactioni

    Subunit structurei

    May form homooligomers and homodimers. Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB and AURKC By similarity. Interacts with BIRC5/survivin and INCENP; interaction is direct. Interacts with SENP3, UBE2I and RANBP2 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi206490. 7 interactions.
    IntActiQ8BHX3. 9 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8BHX3.
    SMRiQ8BHX3. Positions 21-76, 233-289.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 150150Required for interaction with SENP3By similarityAdd
    BLAST
    Regioni1 – 8888Required for centromere localizationBy similarityAdd
    BLAST
    Regioni1 – 5858Required for interaction with INCENPBy similarityAdd
    BLAST
    Regioni10 – 109100Required to form a minimal CPC core complex that localizes to the central spindle and midbody and properly executes the role of the CPC during cytokinesisBy similarityAdd
    BLAST
    Regioni20 – 7859Required for interaction with INCENP and BIRC5By similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi125 – 1328Poly-Glu
    Compositional biasi133 – 1386Poly-Gly

    Domaini

    The C-terminal region (aa 216-289) represents the dimerization motif.By similarity

    Sequence similaritiesi

    Belongs to the borealin family.Curated

    Phylogenomic databases

    eggNOGiNOG39975.
    GeneTreeiENSGT00390000011115.
    HOVERGENiHBG080103.
    InParanoidiB1ARX1.
    KOiK11514.
    OMAiQIESDRQ.
    OrthoDBiEOG7ZPNKN.
    PhylomeDBiQ8BHX3.
    TreeFamiTF101077.

    Family and domain databases

    InterProiIPR018851. Borealin-like_N.
    IPR018867. Cell_div_borealin.
    [Graphical view]
    PfamiPF10512. Borealin. 1 hit.
    PF10444. Nbl1_Borealin_N. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8BHX3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPKKRSSRG TRTNTLRSRK LASFLKDFDR EVQVRTKQIE SDRQTLLKEV    50
    ENLYNIEILR LPKALQGMKW LDYFALGGNK QALEEAAKAD RDITEINNLT 100
    AEAIQTPLKS VKKRKVIEVE ESIKEEEEEE EEGGGGGGRT KKSHKNLRSA 150
    KVKRCLPSKK RTQSIQGRGR SKRLSHDFVT PAMSRLEPSL VKPTPGMTPR 200
    FDSRVFKTPG LRTPAAKEQV YNISINGSPL ADSKEISLSV PIGGGASLRL 250
    LASDLQRIDI AQLNPEALGN IRKLSSRLAQ ICSSIRTGR 289
    Length:289
    Mass (Da):32,214
    Last modified:July 25, 2006 - v2
    Checksum:i3971F9666DA8EEF5
    GO
    Isoform 2 (identifier: Q8BHX3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         276-289: SRLAQICSSIRTGR → GRVILQHLCASLPRLRNESPLRSRLGKLERQEHLRLQRTQVWLSANMAVHL

    Note: No experimental confirmation available.

    Show »
    Length:326
    Mass (Da):36,648
    Checksum:i5AB6F6FEFF61A039
    GO
    Isoform 3 (identifier: Q8BHX3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         129-162: EEEEGGGGGGRTKKSHKNLRSAKVKRCLPSKKRT → QKRAIRIFDLQKSKDAFHPRREPSPYKEEAEVKG
         163-289: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:162
    Mass (Da):18,856
    Checksum:i65CEEF398D5C60C1
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti25 – 251L → P in BAB27258. (PubMed:16141072)Curated
    Sequence conflicti136 – 1361G → E in AAT34966. 1 PublicationCurated
    Sequence conflicti136 – 1361G → E in BAC36334. (PubMed:16141072)Curated
    Sequence conflicti153 – 1531K → E in BAC37258. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei129 – 16234EEEEG…SKKRT → QKRAIRIFDLQKSKDAFHPR REPSPYKEEAEVKG in isoform 3. 1 PublicationVSP_019922Add
    BLAST
    Alternative sequencei163 – 289127Missing in isoform 3. 1 PublicationVSP_019923Add
    BLAST
    Alternative sequencei276 – 28914SRLAQ…IRTGR → GRVILQHLCASLPRLRNESP LRSRLGKLERQEHLRLQRTQ VWLSANMAVHL in isoform 2. 1 PublicationVSP_019924Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY550907 mRNA. Translation: AAT34966.1.
    AK003755 mRNA. Translation: BAB22980.1.
    AK010905 mRNA. Translation: BAB27258.1.
    AK020070 mRNA. Translation: BAB31983.3.
    AK076065 mRNA. Translation: BAC36158.1.
    AK076422 mRNA. Translation: BAC36334.1.
    AK077717 mRNA. Translation: BAC36977.1.
    AK077920 mRNA. Translation: BAC37063.1.
    AK078404 mRNA. Translation: BAC37258.1.
    AK082800 mRNA. Translation: BAC38627.1.
    AL606933 Genomic DNA. Translation: CAM16105.1.
    AL606933 Genomic DNA. Translation: CAM16106.1.
    BC068181 mRNA. Translation: AAH68181.1.
    CCDSiCCDS18631.1. [Q8BHX3-1]
    RefSeqiNP_080836.3. NM_026560.4. [Q8BHX3-1]
    UniGeneiMm.28038.

    Genome annotation databases

    EnsembliENSMUST00000030690; ENSMUSP00000030690; ENSMUSG00000028873. [Q8BHX3-2]
    ENSMUST00000084296; ENSMUSP00000081319; ENSMUSG00000028873. [Q8BHX3-1]
    GeneIDi52276.
    KEGGimmu:52276.
    UCSCiuc008urj.2. mouse. [Q8BHX3-1]
    uc008urk.2. mouse. [Q8BHX3-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY550907 mRNA. Translation: AAT34966.1 .
    AK003755 mRNA. Translation: BAB22980.1 .
    AK010905 mRNA. Translation: BAB27258.1 .
    AK020070 mRNA. Translation: BAB31983.3 .
    AK076065 mRNA. Translation: BAC36158.1 .
    AK076422 mRNA. Translation: BAC36334.1 .
    AK077717 mRNA. Translation: BAC36977.1 .
    AK077920 mRNA. Translation: BAC37063.1 .
    AK078404 mRNA. Translation: BAC37258.1 .
    AK082800 mRNA. Translation: BAC38627.1 .
    AL606933 Genomic DNA. Translation: CAM16105.1 .
    AL606933 Genomic DNA. Translation: CAM16106.1 .
    BC068181 mRNA. Translation: AAH68181.1 .
    CCDSi CCDS18631.1. [Q8BHX3-1 ]
    RefSeqi NP_080836.3. NM_026560.4. [Q8BHX3-1 ]
    UniGenei Mm.28038.

    3D structure databases

    ProteinModelPortali Q8BHX3.
    SMRi Q8BHX3. Positions 21-76, 233-289.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 206490. 7 interactions.
    IntActi Q8BHX3. 9 interactions.

    PTM databases

    PhosphoSitei Q8BHX3.

    Proteomic databases

    PRIDEi Q8BHX3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000030690 ; ENSMUSP00000030690 ; ENSMUSG00000028873 . [Q8BHX3-2 ]
    ENSMUST00000084296 ; ENSMUSP00000081319 ; ENSMUSG00000028873 . [Q8BHX3-1 ]
    GeneIDi 52276.
    KEGGi mmu:52276.
    UCSCi uc008urj.2. mouse. [Q8BHX3-1 ]
    uc008urk.2. mouse. [Q8BHX3-3 ]

    Organism-specific databases

    CTDi 55143.
    MGIi MGI:1196274. Cdca8.

    Phylogenomic databases

    eggNOGi NOG39975.
    GeneTreei ENSGT00390000011115.
    HOVERGENi HBG080103.
    InParanoidi B1ARX1.
    KOi K11514.
    OMAi QIESDRQ.
    OrthoDBi EOG7ZPNKN.
    PhylomeDBi Q8BHX3.
    TreeFami TF101077.

    Enzyme and pathway databases

    Reactomei REACT_198961. Resolution of Sister Chromatid Cohesion.
    REACT_207679. Separation of Sister Chromatids.

    Miscellaneous databases

    NextBioi 308732.
    PROi Q8BHX3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8BHX3.
    Bgeei Q8BHX3.
    CleanExi MM_CDCA8.
    Genevestigatori Q8BHX3.

    Family and domain databases

    InterProi IPR018851. Borealin-like_N.
    IPR018867. Cell_div_borealin.
    [Graphical view ]
    Pfami PF10512. Borealin. 1 hit.
    PF10444. Nbl1_Borealin_N. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The cloning and functional analysis of MESrg."
      Nie Z., Du J., Lu G.
      Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Head, Liver, Testis and Wolffian duct.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: C57BL/6.
      Tissue: Brain.
    5. Cited for: CITRULLINATION AT ARG-91.

    Entry informationi

    Entry nameiBOREA_MOUSE
    AccessioniPrimary (citable) accession number: Q8BHX3
    Secondary accession number(s): B1ARX0
    , B1ARX1, Q6NVD3, Q8BHB1, Q8BHQ5, Q8BHQ9, Q9CRN4, Q9CS02, Q9CTF4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: July 25, 2006
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3