Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Borealin

Gene

Cdca8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment (By similarity).By similarity

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-4615885 SUMOylation of DNA replication proteins
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-68877 Mitotic Prometaphase

Names & Taxonomyi

Protein namesi
Recommended name:
Borealin
Alternative name(s):
Cell division cycle-associated protein 8
MESrg
Gene namesi
Name:Cdca8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1196274 Cdca8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002470761 – 289BorealinAdd BLAST289

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei91Citrulline1 Publication1
Modified residuei94Phosphothreonine; by TTKBy similarity1
Modified residuei106PhosphothreonineCombined sources1
Modified residuei110PhosphoserineBy similarity1
Cross-linki145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei175PhosphoserineCombined sources1
Modified residuei198PhosphothreonineBy similarity1
Modified residuei213PhosphothreonineBy similarity1
Modified residuei228PhosphoserineCombined sources1
Modified residuei233PhosphoserineBy similarity1
Modified residuei247PhosphoserineBy similarity1
Modified residuei253PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by TTK, essentially at Thr-94. Phosphorylation (probably by CDK1) promotes targeting of the CPC to centromeric DNA.By similarity
Sumoylated by UBE2I and RANBP2. Desumoylated by SENP3 through the removal of SUMO2 and SUMO3 (By similarity).By similarity
Citrullinated by PADI4.1 Publication

Keywords - PTMi

Citrullination, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8BHX3
PaxDbiQ8BHX3
PeptideAtlasiQ8BHX3
PRIDEiQ8BHX3

PTM databases

iPTMnetiQ8BHX3
PhosphoSitePlusiQ8BHX3

Expressioni

Gene expression databases

BgeeiENSMUSG00000028873
CleanExiMM_CDCA8
ExpressionAtlasiQ8BHX3 baseline and differential
GenevisibleiQ8BHX3 MM

Interactioni

Subunit structurei

May form homooligomers and homodimers. Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB or AURKC; in the complex forms a triple-helix bundle-based subcomplex with INCENP and BIRC5 (By similarity). Interacts with SENP3, UBE2I and RANBP2. Interacts (phosphorylated) with SGO1 and SGO2; the association is dependent on CDK1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi206490, 20 interactors
IntActiQ8BHX3, 23 interactors
STRINGi10090.ENSMUSP00000081319

Structurei

3D structure databases

ProteinModelPortaliQ8BHX3
SMRiQ8BHX3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 150Required for interaction with SENP3By similarityAdd BLAST150
Regioni1 – 88Required for centromere localizationBy similarityAdd BLAST88
Regioni1 – 58Required for interaction with INCENPBy similarityAdd BLAST58
Regioni10 – 109Required to form a minimal CPC core complex that localizes to the central spindle and midbody and properly executes the role of the CPC during cytokinesisBy similarityAdd BLAST100
Regioni20 – 78Required for interaction with INCENP and BIRC5By similarityAdd BLAST59

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi125 – 132Poly-Glu8
Compositional biasi133 – 138Poly-Gly6

Domaini

The C-terminal region (aa 216-289) represents the dimerization motif.By similarity

Sequence similaritiesi

Belongs to the borealin family.Curated

Phylogenomic databases

eggNOGiENOG410IICJ Eukaryota
ENOG4111N8R LUCA
GeneTreeiENSGT00390000011115
HOVERGENiHBG080103
InParanoidiQ8BHX3
KOiK11514
OMAiQIESDRQ
OrthoDBiEOG091G167R
PhylomeDBiQ8BHX3
TreeFamiTF101077

Family and domain databases

InterProiView protein in InterPro
IPR018851 Borealin_N
IPR018867 Cell_div_borealin
PfamiView protein in Pfam
PF10512 Borealin, 1 hit
PF10444 Nbl1_Borealin_N, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BHX3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPKKRSSRG TRTNTLRSRK LASFLKDFDR EVQVRTKQIE SDRQTLLKEV
60 70 80 90 100
ENLYNIEILR LPKALQGMKW LDYFALGGNK QALEEAAKAD RDITEINNLT
110 120 130 140 150
AEAIQTPLKS VKKRKVIEVE ESIKEEEEEE EEGGGGGGRT KKSHKNLRSA
160 170 180 190 200
KVKRCLPSKK RTQSIQGRGR SKRLSHDFVT PAMSRLEPSL VKPTPGMTPR
210 220 230 240 250
FDSRVFKTPG LRTPAAKEQV YNISINGSPL ADSKEISLSV PIGGGASLRL
260 270 280
LASDLQRIDI AQLNPEALGN IRKLSSRLAQ ICSSIRTGR
Length:289
Mass (Da):32,214
Last modified:July 25, 2006 - v2
Checksum:i3971F9666DA8EEF5
GO
Isoform 2 (identifier: Q8BHX3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-289: SRLAQICSSIRTGR → GRVILQHLCASLPRLRNESPLRSRLGKLERQEHLRLQRTQVWLSANMAVHL

Note: No experimental confirmation available.
Show »
Length:326
Mass (Da):36,648
Checksum:i5AB6F6FEFF61A039
GO
Isoform 3 (identifier: Q8BHX3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-162: EEEEGGGGGGRTKKSHKNLRSAKVKRCLPSKKRT → QKRAIRIFDLQKSKDAFHPRREPSPYKEEAEVKG
     163-289: Missing.

Note: No experimental confirmation available.
Show »
Length:162
Mass (Da):18,856
Checksum:i65CEEF398D5C60C1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25L → P in BAB27258 (PubMed:16141072).Curated1
Sequence conflicti136G → E in AAT34966 (Ref. 1) Curated1
Sequence conflicti136G → E in BAC36334 (PubMed:16141072).Curated1
Sequence conflicti153K → E in BAC37258 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019922129 – 162EEEEG…SKKRT → QKRAIRIFDLQKSKDAFHPR REPSPYKEEAEVKG in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_019923163 – 289Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_019924276 – 289SRLAQ…IRTGR → GRVILQHLCASLPRLRNESP LRSRLGKLERQEHLRLQRTQ VWLSANMAVHL in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY550907 mRNA Translation: AAT34966.1
AK003755 mRNA Translation: BAB22980.1
AK010905 mRNA Translation: BAB27258.1
AK020070 mRNA Translation: BAB31983.3
AK076065 mRNA Translation: BAC36158.1
AK076422 mRNA Translation: BAC36334.1
AK077717 mRNA Translation: BAC36977.1
AK077920 mRNA Translation: BAC37063.1
AK078404 mRNA Translation: BAC37258.1
AK082800 mRNA Translation: BAC38627.1
AL606933 Genomic DNA No translation available.
BC068181 mRNA Translation: AAH68181.1
CCDSiCCDS18631.1 [Q8BHX3-1]
RefSeqiNP_080836.3, NM_026560.4 [Q8BHX3-1]
UniGeneiMm.28038

Genome annotation databases

EnsembliENSMUST00000030690; ENSMUSP00000030690; ENSMUSG00000028873 [Q8BHX3-2]
ENSMUST00000084296; ENSMUSP00000081319; ENSMUSG00000028873 [Q8BHX3-1]
GeneIDi52276
KEGGimmu:52276
UCSCiuc008urj.2 mouse [Q8BHX3-1]
uc008urk.2 mouse [Q8BHX3-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBOREA_MOUSE
AccessioniPrimary (citable) accession number: Q8BHX3
Secondary accession number(s): B1ARX0
, B1ARX1, Q6NVD3, Q8BHB1, Q8BHQ5, Q8BHQ9, Q9CRN4, Q9CS02, Q9CTF4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: July 25, 2006
Last modified: May 23, 2018
This is version 119 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health