Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FERM domain-containing protein 3

Gene

Frmd3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.By similarity

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
FERM domain-containing protein 3
Gene namesi
Name:Frmd3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:2442466 Frmd3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei529 – 549HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003180991 – 595FERM domain-containing protein 3Add BLAST595

Proteomic databases

PaxDbiQ8BHD4
PRIDEiQ8BHD4

PTM databases

iPTMnetiQ8BHD4
PhosphoSitePlusiQ8BHD4

Expressioni

Gene expression databases

BgeeiENSMUSG00000049122
CleanExiMM_FRMD3
GenevisibleiQ8BHD4 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000081514

Structurei

3D structure databases

ProteinModelPortaliQ8BHD4
SMRiQ8BHD4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 312FERMPROSITE-ProRule annotationAdd BLAST281

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3530 Eukaryota
ENOG410XSWH LUCA
GeneTreeiENSGT00760000118823
HOGENOMiHOG000231815
HOVERGENiHBG057180
InParanoidiQ8BHD4
OMAiHICNYYS
OrthoDBiEOG091G06EA
PhylomeDBiQ8BHD4
TreeFamiTF343477

Family and domain databases

CDDicd14473 FERM_B-lobe, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749 Band_41_domain
IPR000798 Ez/rad/moesin-like
IPR014847 FERM-adjacent
IPR014352 FERM/acyl-CoA-bd_prot_sf
IPR035963 FERM_2
IPR019748 FERM_central
IPR019747 FERM_CS
IPR000299 FERM_domain
IPR018979 FERM_N
IPR018980 FERM_PH-like_C
IPR011993 PH-like_dom_sf
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF08736 FA, 1 hit
PF09380 FERM_C, 1 hit
PF00373 FERM_M, 1 hit
PF09379 FERM_N, 1 hit
PRINTSiPR00935 BAND41
PR00661 ERMFAMILY
SMARTiView protein in SMART
SM00295 B41, 1 hit
SM01195 FA, 1 hit
SM01196 FERM_C, 1 hit
SUPFAMiSSF47031 SSF47031, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00660 FERM_1, 1 hit
PS50057 FERM_3, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BHD4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFASCHCAPR GRRTMKMIHF RSSSIKSLNQ EMKCTIRLLD DSEVSCHIQR
60 70 80 90 100
ETKGQFLIEY ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKSH
110 120 130 140 150
PPYTMCFRVK FYPHEPLKIK EELTRYLLYL QIKRDIFHGR LLCSFSDAAY
160 170 180 190 200
LGACIVQAEF GDYYPDEHPE NYISEFEIFP KQSQKLERKI MEIHNNELRG
210 220 230 240 250
QSPAIAEFNL LLKAHTLETY GVDPHPCKDS RGATAFLGFT AAGFVVFQGN
260 270 280 290 300
KRIHLRKWSD VCKLKFEGKT FYVIGSQKEK NAVLAFHTST PAACKHLWKC
310 320 330 340 350
GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR
360 370 380 390 400
DPPEVHRVNI TQSRSFHSLN KQLIINMEPL QPLLPSPTEQ EEEVPVGEGV
410 420 430 440 450
PLPKMDVSEP LIASSPVKGA QCADPPDEEE DRVKEDPLTI SELAYNPSAS
460 470 480 490 500
LLPTPVDDDE INMLFDCPSR LELEREDTDS FEELEADENA FLIAEEEELK
510 520 530 540 550
EARQALSWSY SILTGHIWVN PLVKSFSRLL VVGLGLLLFV FPLLLLLLES
560 570 580 590
GIDLSFLCEI RQTPEFEQFH YEYYCPLKEW VAGKVNIVLY MLGCS
Length:595
Mass (Da):68,448
Last modified:March 1, 2003 - v1
Checksum:i2EB221C15159EE61
GO
Isoform 2 (identifier: Q8BHD4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-595: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVNIVLYMLGCS → VSMP

Note: Gene prediction based on EST data.
Show »
Length:554
Mass (Da):63,546
Checksum:iA2525FCD89FA7924
GO
Isoform 3 (identifier: Q8BHD4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-352: Missing.
     353-356: PEVH → MSVF

Note: No experimental confirmation available.
Show »
Length:243
Mass (Da):27,473
Checksum:iC11A15FB31F22789
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti405M → V in BAC27827 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0311691 – 352Missing in isoform 3. 1 PublicationAdd BLAST352
Alternative sequenceiVSP_031170353 – 356PEVH → MSVF in isoform 3. 1 Publication4
Alternative sequenceiVSP_031168551 – 595GIDLS…MLGCS → VSMP in isoform 2. CuratedAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032348 mRNA Translation: BAC27827.1
AK034956 mRNA Translation: BAC28893.1
AK048561 mRNA Translation: BAC33375.1
AK149095 mRNA Translation: BAE28738.1
AL844607, BX088570, BX957282 Genomic DNA Translation: CAI26161.2
AL844607, BX088570, BX957282 Genomic DNA Translation: CAI26162.2
BX957282, AL844607, BX088570 Genomic DNA Translation: CAI26189.2
BX957282, AL844607, BX088570 Genomic DNA Translation: CAI26190.2
BX088570, AL844607, BX957282 Genomic DNA Translation: CAM19942.1
BX088570, AL844607, BX957282 Genomic DNA Translation: CAM19943.1
BC112419 mRNA Translation: AAI12420.1
BC113795 mRNA Translation: AAI13796.1
BC118964 mRNA Translation: AAI18965.1
CCDSiCCDS38789.1 [Q8BHD4-1]
CCDS51212.1 [Q8BHD4-2]
RefSeqiNP_001157204.1, NM_001163732.1 [Q8BHD4-2]
NP_766457.1, NM_172869.4 [Q8BHD4-1]
UniGeneiMm.221597

Genome annotation databases

EnsembliENSMUST00000084474; ENSMUSP00000081514; ENSMUSG00000049122 [Q8BHD4-1]
ENSMUST00000098006; ENSMUSP00000095615; ENSMUSG00000049122 [Q8BHD4-2]
GeneIDi242506
KEGGimmu:242506
UCSCiuc008tjg.2 mouse [Q8BHD4-1]
uc008tjh.2 mouse [Q8BHD4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFRMD3_MOUSE
AccessioniPrimary (citable) accession number: Q8BHD4
Secondary accession number(s): A2BEJ6
, Q3UF23, Q5SPU0, Q5SPU1, Q8C045
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: March 1, 2003
Last modified: March 28, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health