Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FERM domain-containing protein 3

Gene

Frmd3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
FERM domain-containing protein 3
Gene namesi
Name:Frmd3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:2442466. Frmd3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei529 – 54921HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 595595FERM domain-containing protein 3PRO_0000318099Add
BLAST

Proteomic databases

MaxQBiQ8BHD4.
PaxDbiQ8BHD4.
PRIDEiQ8BHD4.

PTM databases

iPTMnetiQ8BHD4.
PhosphoSiteiQ8BHD4.

Expressioni

Gene expression databases

BgeeiENSMUSG00000049122.
CleanExiMM_FRMD3.
GenevisibleiQ8BHD4. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000081514.

Structurei

3D structure databases

ProteinModelPortaliQ8BHD4.
SMRiQ8BHD4. Positions 30-309.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini32 – 312281FERMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 FERM domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3530. Eukaryota.
ENOG410XSWH. LUCA.
GeneTreeiENSGT00760000118823.
HOGENOMiHOG000231815.
HOVERGENiHBG057180.
InParanoidiQ8BHD4.
OMAiFLCEIRQ.
OrthoDBiEOG091G06EA.
PhylomeDBiQ8BHD4.
TreeFamiTF343477.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR019749. Band_41_domain.
IPR000798. Ez/rad/moesin-like.
IPR014847. FERM-adjacent.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_dom-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF08736. FA. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
PR00661. ERMFAMILY.
SMARTiSM00295. B41. 1 hit.
SM01195. FA. 1 hit.
SM01196. FERM_C. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BHD4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFASCHCAPR GRRTMKMIHF RSSSIKSLNQ EMKCTIRLLD DSEVSCHIQR
60 70 80 90 100
ETKGQFLIEY ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKSH
110 120 130 140 150
PPYTMCFRVK FYPHEPLKIK EELTRYLLYL QIKRDIFHGR LLCSFSDAAY
160 170 180 190 200
LGACIVQAEF GDYYPDEHPE NYISEFEIFP KQSQKLERKI MEIHNNELRG
210 220 230 240 250
QSPAIAEFNL LLKAHTLETY GVDPHPCKDS RGATAFLGFT AAGFVVFQGN
260 270 280 290 300
KRIHLRKWSD VCKLKFEGKT FYVIGSQKEK NAVLAFHTST PAACKHLWKC
310 320 330 340 350
GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR
360 370 380 390 400
DPPEVHRVNI TQSRSFHSLN KQLIINMEPL QPLLPSPTEQ EEEVPVGEGV
410 420 430 440 450
PLPKMDVSEP LIASSPVKGA QCADPPDEEE DRVKEDPLTI SELAYNPSAS
460 470 480 490 500
LLPTPVDDDE INMLFDCPSR LELEREDTDS FEELEADENA FLIAEEEELK
510 520 530 540 550
EARQALSWSY SILTGHIWVN PLVKSFSRLL VVGLGLLLFV FPLLLLLLES
560 570 580 590
GIDLSFLCEI RQTPEFEQFH YEYYCPLKEW VAGKVNIVLY MLGCS
Length:595
Mass (Da):68,448
Last modified:March 1, 2003 - v1
Checksum:i2EB221C15159EE61
GO
Isoform 2 (identifier: Q8BHD4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-595: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVNIVLYMLGCS → VSMP

Note: Gene prediction based on EST data.
Show »
Length:554
Mass (Da):63,546
Checksum:iA2525FCD89FA7924
GO
Isoform 3 (identifier: Q8BHD4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-352: Missing.
     353-356: PEVH → MSVF

Note: No experimental confirmation available.
Show »
Length:243
Mass (Da):27,473
Checksum:iC11A15FB31F22789
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti405 – 4051M → V in BAC27827 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 352352Missing in isoform 3. 1 PublicationVSP_031169Add
BLAST
Alternative sequencei353 – 3564PEVH → MSVF in isoform 3. 1 PublicationVSP_031170
Alternative sequencei551 – 59545GIDLS…MLGCS → VSMP in isoform 2. CuratedVSP_031168Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032348 mRNA. Translation: BAC27827.1.
AK034956 mRNA. Translation: BAC28893.1.
AK048561 mRNA. Translation: BAC33375.1.
AK149095 mRNA. Translation: BAE28738.1.
AL844607, BX088570, BX957282 Genomic DNA. Translation: CAI26161.2.
AL844607, BX088570, BX957282 Genomic DNA. Translation: CAI26162.2.
BX957282, AL844607, BX088570 Genomic DNA. Translation: CAI26189.2.
BX957282, AL844607, BX088570 Genomic DNA. Translation: CAI26190.2.
BX088570, AL844607, BX957282 Genomic DNA. Translation: CAM19942.1.
BX088570, AL844607, BX957282 Genomic DNA. Translation: CAM19943.1.
BC112419 mRNA. Translation: AAI12420.1.
BC113795 mRNA. Translation: AAI13796.1.
BC118964 mRNA. Translation: AAI18965.1.
CCDSiCCDS38789.1. [Q8BHD4-1]
CCDS51212.1. [Q8BHD4-2]
RefSeqiNP_001157204.1. NM_001163732.1. [Q8BHD4-2]
NP_766457.1. NM_172869.4. [Q8BHD4-1]
UniGeneiMm.221597.

Genome annotation databases

EnsembliENSMUST00000084474; ENSMUSP00000081514; ENSMUSG00000049122. [Q8BHD4-1]
ENSMUST00000098006; ENSMUSP00000095615; ENSMUSG00000049122. [Q8BHD4-2]
GeneIDi242506.
KEGGimmu:242506.
UCSCiuc008tjg.2. mouse. [Q8BHD4-1]
uc008tjh.2. mouse. [Q8BHD4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032348 mRNA. Translation: BAC27827.1.
AK034956 mRNA. Translation: BAC28893.1.
AK048561 mRNA. Translation: BAC33375.1.
AK149095 mRNA. Translation: BAE28738.1.
AL844607, BX088570, BX957282 Genomic DNA. Translation: CAI26161.2.
AL844607, BX088570, BX957282 Genomic DNA. Translation: CAI26162.2.
BX957282, AL844607, BX088570 Genomic DNA. Translation: CAI26189.2.
BX957282, AL844607, BX088570 Genomic DNA. Translation: CAI26190.2.
BX088570, AL844607, BX957282 Genomic DNA. Translation: CAM19942.1.
BX088570, AL844607, BX957282 Genomic DNA. Translation: CAM19943.1.
BC112419 mRNA. Translation: AAI12420.1.
BC113795 mRNA. Translation: AAI13796.1.
BC118964 mRNA. Translation: AAI18965.1.
CCDSiCCDS38789.1. [Q8BHD4-1]
CCDS51212.1. [Q8BHD4-2]
RefSeqiNP_001157204.1. NM_001163732.1. [Q8BHD4-2]
NP_766457.1. NM_172869.4. [Q8BHD4-1]
UniGeneiMm.221597.

3D structure databases

ProteinModelPortaliQ8BHD4.
SMRiQ8BHD4. Positions 30-309.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000081514.

PTM databases

iPTMnetiQ8BHD4.
PhosphoSiteiQ8BHD4.

Proteomic databases

MaxQBiQ8BHD4.
PaxDbiQ8BHD4.
PRIDEiQ8BHD4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000084474; ENSMUSP00000081514; ENSMUSG00000049122. [Q8BHD4-1]
ENSMUST00000098006; ENSMUSP00000095615; ENSMUSG00000049122. [Q8BHD4-2]
GeneIDi242506.
KEGGimmu:242506.
UCSCiuc008tjg.2. mouse. [Q8BHD4-1]
uc008tjh.2. mouse. [Q8BHD4-2]

Organism-specific databases

CTDi257019.
MGIiMGI:2442466. Frmd3.

Phylogenomic databases

eggNOGiKOG3530. Eukaryota.
ENOG410XSWH. LUCA.
GeneTreeiENSGT00760000118823.
HOGENOMiHOG000231815.
HOVERGENiHBG057180.
InParanoidiQ8BHD4.
OMAiFLCEIRQ.
OrthoDBiEOG091G06EA.
PhylomeDBiQ8BHD4.
TreeFamiTF343477.

Miscellaneous databases

PROiQ8BHD4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000049122.
CleanExiMM_FRMD3.
GenevisibleiQ8BHD4. MM.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR019749. Band_41_domain.
IPR000798. Ez/rad/moesin-like.
IPR014847. FERM-adjacent.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_dom-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF08736. FA. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
PR00661. ERMFAMILY.
SMARTiSM00295. B41. 1 hit.
SM01195. FA. 1 hit.
SM01196. FERM_C. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFRMD3_MOUSE
AccessioniPrimary (citable) accession number: Q8BHD4
Secondary accession number(s): A2BEJ6
, Q3UF23, Q5SPU0, Q5SPU1, Q8C045
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.