Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Anoctamin-10

Gene

Ano10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1 (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-2672351. Stimuli-sensing channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-10
Alternative name(s):
Transmembrane protein 16K
Gene namesi
Name:Ano10
Synonyms:Tmem16k
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2143103. Ano10.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 207CytoplasmicSequence analysisAdd BLAST207
Transmembranei208 – 228HelicalSequence analysisAdd BLAST21
Topological domaini229 – 240ExtracellularSequence analysisAdd BLAST12
Transmembranei241 – 261HelicalSequence analysisAdd BLAST21
Topological domaini262 – 316CytoplasmicSequence analysisAdd BLAST55
Transmembranei317 – 337HelicalSequence analysisAdd BLAST21
Topological domaini338 – 352ExtracellularSequence analysisAdd BLAST15
Transmembranei353 – 373HelicalSequence analysisAdd BLAST21
Topological domaini374 – 400CytoplasmicSequence analysisAdd BLAST27
Transmembranei401 – 421HelicalSequence analysisAdd BLAST21
Topological domaini422 – 500ExtracellularSequence analysisAdd BLAST79
Transmembranei501 – 521HelicalSequence analysisAdd BLAST21
Topological domaini522 – 553CytoplasmicSequence analysisAdd BLAST32
Transmembranei554 – 574HelicalSequence analysisAdd BLAST21
Topological domaini575 – 590ExtracellularSequence analysisAdd BLAST16
Transmembranei591 – 611HelicalSequence analysisAdd BLAST21
Topological domaini612 – 659CytoplasmicSequence analysisAdd BLAST48

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • intracellular Source: MGI
  • membrane Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002899581 – 659Anoctamin-10Add BLAST659

Proteomic databases

PaxDbiQ8BH79.
PeptideAtlasiQ8BH79.
PRIDEiQ8BH79.

PTM databases

PhosphoSitePlusiQ8BH79.

Expressioni

Tissue specificityi

Predominant expression seen in epithelial tissues.1 Publication

Developmental stagei

Detected in the mantle layer of the neural tube and in the dorsal root ganglia at E14.5.1 Publication

Gene expression databases

BgeeiENSMUSG00000037949.
GenevisibleiQ8BH79. MM.

Interactioni

Protein-protein interaction databases

IntActiQ8BH79. 1 interactor.
STRINGi10090.ENSMUSP00000045214.

Structurei

3D structure databases

ProteinModelPortaliQ8BH79.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2513. Eukaryota.
ENOG410XPYE. LUCA.
GeneTreeiENSGT00760000119015.
HOVERGENiHBG071385.
InParanoidiQ8BH79.
KOiK19327.
OMAiLENQNLY.
OrthoDBiEOG091G06A3.
PhylomeDBiQ8BH79.
TreeFamiTF314265.

Family and domain databases

InterProiIPR007632. Anoctamin.
IPR031291. Anoctamin-10.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PTHR12308:SF40. PTHR12308:SF40. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BH79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVTLSTLDT CESSFTPLVV IELAQDVKDE TKEWLKNRII AKKKDGGAQL
60 70 80 90 100
LFRPLLNKYE KETLENQNLY LVGASNVRLL LGAEAVGLVK ECTDAAMRAF
110 120 130 140 150
TYGTRHNFKG FHDNNNDFLT MAECQFIIKH ELENLRARDE KMIPGYPQAK
160 170 180 190 200
LYPGKSLMRR LLTSGIVTQV FPLHDTEALK KLEDTWYTRF ALKYQPIDSI
210 220 230 240 250
RSYFGETIAL YFGFLEYFTF ALIPMAIIGL PYYLFVWEDY DKYVIFASFN
260 270 280 290 300
LIWSTVILEV WKRGCANMTY RWGTLVMKRQ FEEPRPGFHG VLGINSVTGR
310 320 330 340 350
EEPLYSSYKR QLRIYLVSLP FVCLCLYFSL YVMMIYFDME DWALSLHEDS
360 370 380 390 400
GSEWTSLLLY VPSIVYAVVI EIMNRLYRYA AEFLTSWENH RLESAYQNHL
410 420 430 440 450
VLKVLVFNFL NCFASLFYIA FVLKDMKLLR QSLATLLITS QILNQVVESL
460 470 480 490 500
LPYWLQRKYC ARVKRKVQAL KSEVDTTLYE QVLLEKEMGT YLGTFDDYLE
510 520 530 540 550
LFLQFGYVSL FSCVYPLAAA FAVLNNFTEV NSDALKMCRV FKRPFAEPSA
560 570 580 590 600
SIGVWQLAFE TMSVISVVTN CALIGMSPQV NAVFPESKTD LVLIVVAVEH
610 620 630 640 650
ALLALKFILA FAIPDKPRHI QQKLARLEFE SLEALKQQQM KLVAENLKEE

YQEDGKEAT
Length:659
Mass (Da):76,188
Last modified:March 1, 2003 - v1
Checksum:i435D9A08D48F93FC
GO
Isoform 2 (identifier: Q8BH79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-255: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):69,263
Checksum:iE658580D5467DA5C
GO
Isoform 3 (identifier: Q8BH79-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     600-612: HALLALKFILAFA → VLGLQASFTIGFY
     613-659: Missing.

Note: No experimental confirmation available.
Show »
Length:612
Mass (Da):70,641
Checksum:iD813258D71D5FB3B
GO
Isoform 4 (identifier: Q8BH79-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     639-659: QMKLVAENLKEEYQEDGKEAT → VRAVCLETLLDYIPLAQAPSHCVSFSMDLSVK

Note: No experimental confirmation available.
Show »
Length:670
Mass (Da):77,241
Checksum:iCD94C0B3B9BFFB0D
GO

Sequence cautioni

The sequence AAH26421 differs from that shown. Contaminating sequence.Curated
The sequence BAC25927 differs from that shown. Reason: Frameshift at position 579.Curated
The sequence BAC37706 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026034198 – 255Missing in isoform 2. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_026035600 – 612HALLA…ILAFA → VLGLQASFTIGFY in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_026036613 – 659Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_026037639 – 659QMKLV…GKEAT → VRAVCLETLLDYIPLAQAPS HCVSFSMDLSVK in isoform 4. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028391 mRNA. Translation: BAC25927.1. Sequence problems.
AK046091 mRNA. Translation: BAC32601.1.
AK054163 mRNA. Translation: BAC35676.1.
AK079622 mRNA. Translation: BAC37706.1. Different initiation.
AK080947 mRNA. Translation: BAC38086.1.
BC002294 mRNA. Translation: AAH02294.1.
BC026421 mRNA. Translation: AAH26421.1. Sequence problems.
BC099688 mRNA. Translation: AAH99688.1.
CCDSiCCDS23645.1. [Q8BH79-1]
RefSeqiNP_001258802.1. NM_001271873.1. [Q8BH79-2]
NP_598740.1. NM_133979.3. [Q8BH79-1]
XP_011241230.1. XM_011242928.2. [Q8BH79-4]
UniGeneiMm.87676.

Genome annotation databases

EnsembliENSMUST00000042546; ENSMUSP00000045214; ENSMUSG00000037949. [Q8BH79-1]
GeneIDi102566.
KEGGimmu:102566.
UCSCiuc009ser.2. mouse. [Q8BH79-1]
uc009ses.2. mouse. [Q8BH79-2]
uc009seu.1. mouse. [Q8BH79-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028391 mRNA. Translation: BAC25927.1. Sequence problems.
AK046091 mRNA. Translation: BAC32601.1.
AK054163 mRNA. Translation: BAC35676.1.
AK079622 mRNA. Translation: BAC37706.1. Different initiation.
AK080947 mRNA. Translation: BAC38086.1.
BC002294 mRNA. Translation: AAH02294.1.
BC026421 mRNA. Translation: AAH26421.1. Sequence problems.
BC099688 mRNA. Translation: AAH99688.1.
CCDSiCCDS23645.1. [Q8BH79-1]
RefSeqiNP_001258802.1. NM_001271873.1. [Q8BH79-2]
NP_598740.1. NM_133979.3. [Q8BH79-1]
XP_011241230.1. XM_011242928.2. [Q8BH79-4]
UniGeneiMm.87676.

3D structure databases

ProteinModelPortaliQ8BH79.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BH79. 1 interactor.
STRINGi10090.ENSMUSP00000045214.

PTM databases

PhosphoSitePlusiQ8BH79.

Proteomic databases

PaxDbiQ8BH79.
PeptideAtlasiQ8BH79.
PRIDEiQ8BH79.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042546; ENSMUSP00000045214; ENSMUSG00000037949. [Q8BH79-1]
GeneIDi102566.
KEGGimmu:102566.
UCSCiuc009ser.2. mouse. [Q8BH79-1]
uc009ses.2. mouse. [Q8BH79-2]
uc009seu.1. mouse. [Q8BH79-4]

Organism-specific databases

CTDi55129.
MGIiMGI:2143103. Ano10.

Phylogenomic databases

eggNOGiKOG2513. Eukaryota.
ENOG410XPYE. LUCA.
GeneTreeiENSGT00760000119015.
HOVERGENiHBG071385.
InParanoidiQ8BH79.
KOiK19327.
OMAiLENQNLY.
OrthoDBiEOG091G06A3.
PhylomeDBiQ8BH79.
TreeFamiTF314265.

Enzyme and pathway databases

ReactomeiR-MMU-2672351. Stimuli-sensing channels.

Miscellaneous databases

PROiQ8BH79.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037949.
GenevisibleiQ8BH79. MM.

Family and domain databases

InterProiIPR007632. Anoctamin.
IPR031291. Anoctamin-10.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PTHR12308:SF40. PTHR12308:SF40. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANO10_MOUSE
AccessioniPrimary (citable) accession number: Q8BH79
Secondary accession number(s): Q4FZD2
, Q8BMS8, Q8BV74, Q8BW67, Q8R0U0, Q99LP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.