Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Anoctamin-10

Gene

Ano10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1 (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-2672351. Stimuli-sensing channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-10
Alternative name(s):
Transmembrane protein 16K
Gene namesi
Name:Ano10
Synonyms:Tmem16k
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2143103. Ano10.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 207207CytoplasmicSequence analysisAdd
BLAST
Transmembranei208 – 22821HelicalSequence analysisAdd
BLAST
Topological domaini229 – 24012ExtracellularSequence analysisAdd
BLAST
Transmembranei241 – 26121HelicalSequence analysisAdd
BLAST
Topological domaini262 – 31655CytoplasmicSequence analysisAdd
BLAST
Transmembranei317 – 33721HelicalSequence analysisAdd
BLAST
Topological domaini338 – 35215ExtracellularSequence analysisAdd
BLAST
Transmembranei353 – 37321HelicalSequence analysisAdd
BLAST
Topological domaini374 – 40027CytoplasmicSequence analysisAdd
BLAST
Transmembranei401 – 42121HelicalSequence analysisAdd
BLAST
Topological domaini422 – 50079ExtracellularSequence analysisAdd
BLAST
Transmembranei501 – 52121HelicalSequence analysisAdd
BLAST
Topological domaini522 – 55332CytoplasmicSequence analysisAdd
BLAST
Transmembranei554 – 57421HelicalSequence analysisAdd
BLAST
Topological domaini575 – 59016ExtracellularSequence analysisAdd
BLAST
Transmembranei591 – 61121HelicalSequence analysisAdd
BLAST
Topological domaini612 – 65948CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • intracellular Source: MGI
  • membrane Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 659659Anoctamin-10PRO_0000289958Add
BLAST

Proteomic databases

EPDiQ8BH79.
MaxQBiQ8BH79.
PaxDbiQ8BH79.
PRIDEiQ8BH79.

PTM databases

PhosphoSiteiQ8BH79.

Expressioni

Tissue specificityi

Predominant expression seen in epithelial tissues.1 Publication

Developmental stagei

Detected in the mantle layer of the neural tube and in the dorsal root ganglia at E14.5.1 Publication

Gene expression databases

BgeeiQ8BH79.
GenevisibleiQ8BH79. MM.

Interactioni

Protein-protein interaction databases

IntActiQ8BH79. 1 interaction.
STRINGi10090.ENSMUSP00000045214.

Structurei

3D structure databases

ProteinModelPortaliQ8BH79.
SMRiQ8BH79. Positions 167-640.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2513. Eukaryota.
ENOG410XPYE. LUCA.
GeneTreeiENSGT00760000119015.
HOVERGENiHBG071385.
InParanoidiQ8BH79.
KOiK19327.
OMAiLENQNLY.
OrthoDBiEOG7FNC6Q.
PhylomeDBiQ8BH79.
TreeFamiTF314265.

Family and domain databases

InterProiIPR007632. Anoctamin.
IPR031291. Anoctamin-10.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PTHR12308:SF40. PTHR12308:SF40. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BH79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVTLSTLDT CESSFTPLVV IELAQDVKDE TKEWLKNRII AKKKDGGAQL
60 70 80 90 100
LFRPLLNKYE KETLENQNLY LVGASNVRLL LGAEAVGLVK ECTDAAMRAF
110 120 130 140 150
TYGTRHNFKG FHDNNNDFLT MAECQFIIKH ELENLRARDE KMIPGYPQAK
160 170 180 190 200
LYPGKSLMRR LLTSGIVTQV FPLHDTEALK KLEDTWYTRF ALKYQPIDSI
210 220 230 240 250
RSYFGETIAL YFGFLEYFTF ALIPMAIIGL PYYLFVWEDY DKYVIFASFN
260 270 280 290 300
LIWSTVILEV WKRGCANMTY RWGTLVMKRQ FEEPRPGFHG VLGINSVTGR
310 320 330 340 350
EEPLYSSYKR QLRIYLVSLP FVCLCLYFSL YVMMIYFDME DWALSLHEDS
360 370 380 390 400
GSEWTSLLLY VPSIVYAVVI EIMNRLYRYA AEFLTSWENH RLESAYQNHL
410 420 430 440 450
VLKVLVFNFL NCFASLFYIA FVLKDMKLLR QSLATLLITS QILNQVVESL
460 470 480 490 500
LPYWLQRKYC ARVKRKVQAL KSEVDTTLYE QVLLEKEMGT YLGTFDDYLE
510 520 530 540 550
LFLQFGYVSL FSCVYPLAAA FAVLNNFTEV NSDALKMCRV FKRPFAEPSA
560 570 580 590 600
SIGVWQLAFE TMSVISVVTN CALIGMSPQV NAVFPESKTD LVLIVVAVEH
610 620 630 640 650
ALLALKFILA FAIPDKPRHI QQKLARLEFE SLEALKQQQM KLVAENLKEE

YQEDGKEAT
Length:659
Mass (Da):76,188
Last modified:March 1, 2003 - v1
Checksum:i435D9A08D48F93FC
GO
Isoform 2 (identifier: Q8BH79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-255: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):69,263
Checksum:iE658580D5467DA5C
GO
Isoform 3 (identifier: Q8BH79-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     600-612: HALLALKFILAFA → VLGLQASFTIGFY
     613-659: Missing.

Note: No experimental confirmation available.
Show »
Length:612
Mass (Da):70,641
Checksum:iD813258D71D5FB3B
GO
Isoform 4 (identifier: Q8BH79-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     639-659: QMKLVAENLKEEYQEDGKEAT → VRAVCLETLLDYIPLAQAPSHCVSFSMDLSVK

Note: No experimental confirmation available.
Show »
Length:670
Mass (Da):77,241
Checksum:iCD94C0B3B9BFFB0D
GO

Sequence cautioni

The sequence AAH26421.1 differs from that shown.Contaminating sequence.Curated
The sequence BAC25927.1 differs from that shown. Reason: Frameshift at position 579. Curated
The sequence BAC37706.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei198 – 25558Missing in isoform 2. 1 PublicationVSP_026034Add
BLAST
Alternative sequencei600 – 61213HALLA…ILAFA → VLGLQASFTIGFY in isoform 3. 1 PublicationVSP_026035Add
BLAST
Alternative sequencei613 – 65947Missing in isoform 3. 1 PublicationVSP_026036Add
BLAST
Alternative sequencei639 – 65921QMKLV…GKEAT → VRAVCLETLLDYIPLAQAPS HCVSFSMDLSVK in isoform 4. 1 PublicationVSP_026037Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028391 mRNA. Translation: BAC25927.1. Sequence problems.
AK046091 mRNA. Translation: BAC32601.1.
AK054163 mRNA. Translation: BAC35676.1.
AK079622 mRNA. Translation: BAC37706.1. Different initiation.
AK080947 mRNA. Translation: BAC38086.1.
BC002294 mRNA. Translation: AAH02294.1.
BC026421 mRNA. Translation: AAH26421.1. Sequence problems.
BC099688 mRNA. Translation: AAH99688.1.
CCDSiCCDS23645.1. [Q8BH79-1]
RefSeqiNP_001258802.1. NM_001271873.1. [Q8BH79-2]
NP_598740.1. NM_133979.3. [Q8BH79-1]
XP_011241230.1. XM_011242928.1. [Q8BH79-4]
UniGeneiMm.87676.

Genome annotation databases

EnsembliENSMUST00000042546; ENSMUSP00000045214; ENSMUSG00000037949. [Q8BH79-1]
GeneIDi102566.
KEGGimmu:102566.
UCSCiuc009ser.2. mouse. [Q8BH79-1]
uc009ses.2. mouse. [Q8BH79-2]
uc009seu.1. mouse. [Q8BH79-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028391 mRNA. Translation: BAC25927.1. Sequence problems.
AK046091 mRNA. Translation: BAC32601.1.
AK054163 mRNA. Translation: BAC35676.1.
AK079622 mRNA. Translation: BAC37706.1. Different initiation.
AK080947 mRNA. Translation: BAC38086.1.
BC002294 mRNA. Translation: AAH02294.1.
BC026421 mRNA. Translation: AAH26421.1. Sequence problems.
BC099688 mRNA. Translation: AAH99688.1.
CCDSiCCDS23645.1. [Q8BH79-1]
RefSeqiNP_001258802.1. NM_001271873.1. [Q8BH79-2]
NP_598740.1. NM_133979.3. [Q8BH79-1]
XP_011241230.1. XM_011242928.1. [Q8BH79-4]
UniGeneiMm.87676.

3D structure databases

ProteinModelPortaliQ8BH79.
SMRiQ8BH79. Positions 167-640.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BH79. 1 interaction.
STRINGi10090.ENSMUSP00000045214.

PTM databases

PhosphoSiteiQ8BH79.

Proteomic databases

EPDiQ8BH79.
MaxQBiQ8BH79.
PaxDbiQ8BH79.
PRIDEiQ8BH79.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042546; ENSMUSP00000045214; ENSMUSG00000037949. [Q8BH79-1]
GeneIDi102566.
KEGGimmu:102566.
UCSCiuc009ser.2. mouse. [Q8BH79-1]
uc009ses.2. mouse. [Q8BH79-2]
uc009seu.1. mouse. [Q8BH79-4]

Organism-specific databases

CTDi55129.
MGIiMGI:2143103. Ano10.

Phylogenomic databases

eggNOGiKOG2513. Eukaryota.
ENOG410XPYE. LUCA.
GeneTreeiENSGT00760000119015.
HOVERGENiHBG071385.
InParanoidiQ8BH79.
KOiK19327.
OMAiLENQNLY.
OrthoDBiEOG7FNC6Q.
PhylomeDBiQ8BH79.
TreeFamiTF314265.

Enzyme and pathway databases

ReactomeiR-MMU-2672351. Stimuli-sensing channels.

Miscellaneous databases

NextBioi355532.
PROiQ8BH79.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BH79.
GenevisibleiQ8BH79. MM.

Family and domain databases

InterProiIPR007632. Anoctamin.
IPR031291. Anoctamin-10.
[Graphical view]
PANTHERiPTHR12308. PTHR12308. 1 hit.
PTHR12308:SF40. PTHR12308:SF40. 1 hit.
PfamiPF04547. Anoctamin. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 193-659 (ISOFORM 4).
    Strain: C57BL/6J and Czech II.
    Tissue: Adipose tissue, Corpora quadrigemina, Oviduct and Spinal cord.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Kidney, Mammary tumor and Olfactory epithelium.
  3. "Expression of TMEM16 paralogs during murine embryogenesis."
    Rock J.R., Harfe B.D.
    Dev. Dyn. 237:2566-2574(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Testis.
  5. Cited for: TISSUE SPECIFICITY.
  6. "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age."
    Winpenny J.P., Gray M.A.
    Exp. Physiol. 97:175-176(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.

Entry informationi

Entry nameiANO10_MOUSE
AccessioniPrimary (citable) accession number: Q8BH79
Secondary accession number(s): Q4FZD2
, Q8BMS8, Q8BV74, Q8BW67, Q8R0U0, Q99LP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: March 1, 2003
Last modified: March 16, 2016
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.