Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PAB-dependent poly(A)-specific ribonuclease subunit PAN2

Gene

Pan2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic subunit of the poly(A)-nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly(A) tails of RNA when the poly(A) stretch is bound by poly(A)-binding protein (PABP), which is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degradation by XRN1.UniRule annotation1 Publication

Catalytic activityi

Exonucleolytic cleavage of poly(A) to 5'-AMP.UniRule annotation

Enzyme regulationi

Positively regulated by the regulatory subunit PAN3.UniRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Exonuclease, Hydrolase, Nuclease

Keywords - Biological processi

mRNA processing

Enzyme and pathway databases

ReactomeiR-MMU-429947. Deadenylation of mRNA.

Protein family/group databases

MEROPSiC19.978.

Names & Taxonomyi

Protein namesi
Recommended name:
PAB-dependent poly(A)-specific ribonuclease subunit PAN2UniRule annotation (EC:3.1.13.4UniRule annotation)
Alternative name(s):
Inactive ubiquitin carboxyl-terminal hydrolase 52UniRule annotation
PAB1P-dependent poly(A)-nucleaseUniRule annotation
PAN deadenylation complex catalytic subunit 2UniRule annotation
Gene namesi
Name:Pan2
Synonyms:Kiaa0710, Usp52
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1918984. Pan2.

Subcellular locationi

  • CytoplasmP-body UniRule annotation1 Publication
  • Nucleus UniRule annotation

  • Note: Shuttles between nucleus and cytoplasm.UniRule annotation

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytoplasmic mRNA processing body Source: MGI
  • nucleus Source: UniProtKB-SubCell
  • PAN complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002805221 – 1200PAB-dependent poly(A)-specific ribonuclease subunit PAN2Add BLAST1200

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei784PhosphoserineCombined sources1
Modified residuei1188PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BGF7.
PeptideAtlasiQ8BGF7.
PRIDEiQ8BGF7.

PTM databases

iPTMnetiQ8BGF7.
PhosphoSitePlusiQ8BGF7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000005682.
GenevisibleiQ8BGF7. MM.

Interactioni

Subunit structurei

Interacts with the regulatory subunit PAN3 to form the poly(A)-nuclease (PAN) deadenylation complex (By similarity). Interacts with ZFP36 (PubMed:21078877).UniRule annotation1 Publication

Protein-protein interaction databases

IntActiQ8BGF7. 1 interactor.
STRINGi10090.ENSMUSP00000005825.

Structurei

3D structure databases

ProteinModelPortaliQ8BGF7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati153 – 193WD 1Add BLAST41
Repeati195 – 231WD 2Add BLAST37
Repeati244 – 280WD 3Add BLAST37
Repeati328 – 367WD 4Add BLAST40
Domaini516 – 923USPUniRule annotationAdd BLAST408
Domaini974 – 1146ExonucleaseUniRule annotationAdd BLAST173

Sequence similaritiesi

Belongs to the peptidase C19 family. PAN2 subfamily.UniRule annotation
Contains 1 exonuclease domain.UniRule annotation
Contains 1 USP domain.UniRule annotation
Contains 4 WD repeats.UniRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1275. Eukaryota.
COG0847. LUCA.
GeneTreeiENSGT00390000013978.
HOGENOMiHOG000230585.
HOVERGENiHBG089847.
InParanoidiQ8BGF7.
KOiK12571.
OMAiILHQMHY.
OrthoDBiEOG091G01KS.
PhylomeDBiQ8BGF7.
TreeFamiTF105657.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.30.420.10. 1 hit.
HAMAPiMF_03182. PAN2. 1 hit.
InterProiIPR013520. Exonuclease_RNaseT/DNA_pol3.
IPR030843. PAN2.
IPR028881. PAN2_dom.
IPR012337. RNaseH-like_dom.
IPR028889. USP_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00929. RNase_T. 1 hit.
PF13423. UCH_1. 1 hit.
[Graphical view]
SMARTiSM00479. EXOIII. 1 hit.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF53098. SSF53098. 1 hit.
PROSITEiPS50235. USP_3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BGF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNFEGLDPGL AEFSPAMHST LDPVLDAHLN PSLLQNVELD PEGVALEALP
60 70 80 90 100
VQESVHIMEG VYSELHSVVA EVGVPVSVSH FDLHEEMLWV GSHGGHATSF
110 120 130 140 150
FGPALERYSS FQVNGGDDIR QIQSLENGIL FLTKNNLKYM ARGGLIIFDY
160 170 180 190 200
LLDENEDMHS VLLTDNSTLL VGGLQNHVLE IDLNTVQETQ KYAVETPGVT
210 220 230 240 250
IMRQTNRFFF CGHTSGKVSL RDLRSFKVEH EFDAFSGSLS DFDVHGNLLA
260 270 280 290 300
ACGFSSRLTG LACDRFLKVY DLRMMRAITP LQVHVDPAFL RFIPTYTSRL
310 320 330 340 350
AIISQSGQCQ FCEPTGLANP ADIFHVNPVG PLLMTFDVSA SKQALAFGDS
360 370 380 390 400
EGCVHLWTDS PEPSFNPYSR ETEFALPCLV DSLPPLDWSQ DLLPLSLIPV
410 420 430 440 450
PLTTDALLSD WPAANSAPAP RRAPPVDAEI LRTMKKVGFI GYAPNPRTRL
460 470 480 490 500
RNQIPYRLKE SDHEFDNFSQ VTESPTGREE EPLHTVSKKY RKVTIKYSKL
510 520 530 540 550
GLEDFDFKHY NKTLFAGLEP HIPNAYCNCM IQVLYFLEPV RCLIQNHLCQ
560 570 580 590 600
KEFCLACELG FLFHMLDLSR GDPCQGSNFL RAFRTIPEAS ALGLILADSD
610 620 630 640 650
EASGKGSLAR LIQRWNRFIL TQLHQDMQEL EVPQAYRGAG GSFCSSGDSI
660 670 680 690 700
IGQLFSCEME NCSLCRCGSE TVRASSTLLF TLSYPEDKTG KNYDFAQVLK
710 720 730 740 750
RSICLEQNTQ AWCDNCEKYQ PTIQTRNIRH LPDILVINCE VNSSKEADFW
760 770 780 790 800
RLQAEVAFKI AVKKYGGEMK SKEFALADRK ELRSPEGFLC SSIEELKNVW
810 820 830 840 850
LPFSIRMKMT KNKGLDVCNW ADEHELSSLG APSQWGPARA EEELGVYVYD
860 870 880 890 900
LMATVVHILD SRTGGSLVAH IKVGETYHQR KEGVTHQQWY LFNDFLIEPI
910 920 930 940 950
DKYEAVQFDM NWKVPAILYY VKRNLNSRYN LNIKNPIEAS VLLAEASLAR
960 970 980 990 1000
KQRKTHTTFI PLMLNEMPQV GDLVGLDAEF VTLNEEEAEL RSDGTKSTIK
1010 1020 1030 1040 1050
PSQMSVARIT CVRGQGPNEG IPFIDDYIST QEQVVDYLTQ YSGIKPGDLD
1060 1070 1080 1090 1100
AKISSKHLTT LKSTYLKLRF LIDIGVKFVG HGLQKDFRVI NLMVPKDQVL
1110 1120 1130 1140 1150
DTVYLFHMPR KRMISLRFLA WYFLDLKIQG ETHDSIEDAR TALQLYRKYL
1160 1170 1180 1190 1200
ELSKNGTEPE SFHKVLKGLY EKGRKMDWKV PEPESQTSPK NAAVFSVLAL
Length:1,200
Mass (Da):135,253
Last modified:March 1, 2003 - v1
Checksum:i9CE98D3BE9FCE182
GO
Isoform 2 (identifier: Q8BGF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-834: Missing.

Show »
Length:1,191
Mass (Da):134,413
Checksum:i7EA787D6AEE01B1B
GO
Isoform 3 (identifier: Q8BGF7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-112: Missing.
     826-834: Missing.

Note: No experimental confirmation available.
Show »
Length:1,173
Mass (Da):132,428
Checksum:iFE2477B2C38DDC95
GO
Isoform 4 (identifier: Q8BGF7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-722: DKTGKNYDFAQVLKRSICLEQNTQAWCDNCEKYQPT → GS

Note: No experimental confirmation available.
Show »
Length:1,166
Mass (Da):131,176
Checksum:i7BE7611362D0DC72
GO

Sequence cautioni

The sequence BAC98006 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti175Q → L in BAE34203 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02375095 – 112Missing in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_023751687 – 722DKTGK…KYQPT → GS in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_023752826 – 834Missing in isoform 2 and isoform 3. 2 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129196 Transcribed RNA. Translation: BAC98006.2. Different initiation.
AK047887 mRNA. Translation: BAC33183.1.
AK089001 mRNA. Translation: BAC40693.1.
AK157800 mRNA. Translation: BAE34203.1.
BC075686 mRNA. Translation: AAH75686.1.
BC079841 mRNA. Translation: AAH79841.1.
CCDSiCCDS24271.1. [Q8BGF7-1]
RefSeqiNP_001239255.1. NM_001252326.1. [Q8BGF7-2]
NP_001239256.1. NM_001252327.1. [Q8BGF7-3]
NP_598753.1. NM_133992.3. [Q8BGF7-1]
UniGeneiMm.244183.
Mm.489673.

Genome annotation databases

EnsembliENSMUST00000005825; ENSMUSP00000005825; ENSMUSG00000005682. [Q8BGF7-1]
GeneIDi103135.
KEGGimmu:103135.
UCSCiuc007hme.2. mouse. [Q8BGF7-1]
uc007hmf.2. mouse. [Q8BGF7-2]
uc007hmg.2. mouse. [Q8BGF7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129196 Transcribed RNA. Translation: BAC98006.2. Different initiation.
AK047887 mRNA. Translation: BAC33183.1.
AK089001 mRNA. Translation: BAC40693.1.
AK157800 mRNA. Translation: BAE34203.1.
BC075686 mRNA. Translation: AAH75686.1.
BC079841 mRNA. Translation: AAH79841.1.
CCDSiCCDS24271.1. [Q8BGF7-1]
RefSeqiNP_001239255.1. NM_001252326.1. [Q8BGF7-2]
NP_001239256.1. NM_001252327.1. [Q8BGF7-3]
NP_598753.1. NM_133992.3. [Q8BGF7-1]
UniGeneiMm.244183.
Mm.489673.

3D structure databases

ProteinModelPortaliQ8BGF7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BGF7. 1 interactor.
STRINGi10090.ENSMUSP00000005825.

Protein family/group databases

MEROPSiC19.978.

PTM databases

iPTMnetiQ8BGF7.
PhosphoSitePlusiQ8BGF7.

Proteomic databases

PaxDbiQ8BGF7.
PeptideAtlasiQ8BGF7.
PRIDEiQ8BGF7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000005825; ENSMUSP00000005825; ENSMUSG00000005682. [Q8BGF7-1]
GeneIDi103135.
KEGGimmu:103135.
UCSCiuc007hme.2. mouse. [Q8BGF7-1]
uc007hmf.2. mouse. [Q8BGF7-2]
uc007hmg.2. mouse. [Q8BGF7-3]

Organism-specific databases

CTDi9924.
MGIiMGI:1918984. Pan2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1275. Eukaryota.
COG0847. LUCA.
GeneTreeiENSGT00390000013978.
HOGENOMiHOG000230585.
HOVERGENiHBG089847.
InParanoidiQ8BGF7.
KOiK12571.
OMAiILHQMHY.
OrthoDBiEOG091G01KS.
PhylomeDBiQ8BGF7.
TreeFamiTF105657.

Enzyme and pathway databases

ReactomeiR-MMU-429947. Deadenylation of mRNA.

Miscellaneous databases

ChiTaRSiPan2. mouse.
PROiQ8BGF7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000005682.
GenevisibleiQ8BGF7. MM.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.30.420.10. 1 hit.
HAMAPiMF_03182. PAN2. 1 hit.
InterProiIPR013520. Exonuclease_RNaseT/DNA_pol3.
IPR030843. PAN2.
IPR028881. PAN2_dom.
IPR012337. RNaseH-like_dom.
IPR028889. USP_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00929. RNase_T. 1 hit.
PF13423. UCH_1. 1 hit.
[Graphical view]
SMARTiSM00479. EXOIII. 1 hit.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
SSF53098. SSF53098. 1 hit.
PROSITEiPS50235. USP_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPAN2_MOUSE
AccessioniPrimary (citable) accession number: Q8BGF7
Secondary accession number(s): Q3TZK5, Q68FH6, Q6ZQ63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 1, 2003
Last modified: November 2, 2016
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

Has probably no ubiquitin carboxyl terminal hydrolase activity since it lacks a conserved catalytic Cys at position 524.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.