Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PAN2-PAN3 deadenylation complex catalytic subunit Pan2

Gene

Pan2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic subunit of the poly(A)-nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly(A) tails of RNA and the activity is stimulated by poly(A)-binding protein (PABP). PAN deadenylation is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degradation by XRN1 (PubMed:16284618). Also acts as an important regulator of the HIF1A-mediated hypoxic response. Required for HIF1A mRNA stability independent of poly(A) tail length regulation (By similarity).UniRule annotation1 Publication

Catalytic activityi

Exonucleolytic cleavage of poly(A) to 5'-AMP.UniRule annotation

Cofactori

a divalent metal cationUniRule annotationNote: Binds 2 metal cations per subunit in the catalytic exonuclease domain.UniRule annotation

Enzyme regulationi

Positively regulated by the regulatory subunit PAN3.UniRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi977Divalent metal cation; catalyticUniRule annotation1
Metal bindingi979Divalent metal cation; catalyticUniRule annotation1
Metal bindingi1086Divalent metal cation; catalyticUniRule annotation1
Metal bindingi1138Divalent metal cation; catalyticUniRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionExonuclease, Hydrolase, Nuclease
Biological processmRNA processing
LigandMetal-binding

Protein family/group databases

MEROPSiC19.978

Names & Taxonomyi

Protein namesi
Recommended name:
PAN2-PAN3 deadenylation complex catalytic subunit Pan2UniRule annotation (EC:3.1.13.4UniRule annotation)
Alternative name(s):
Inactive ubiquitin carboxyl-terminal hydrolase 52UniRule annotation
PAB1P-dependent poly(A)-specific ribonucleaseUniRule annotation
Poly(A)-nuclease deadenylation complex subunit 2UniRule annotation
Short name:
PAN deadenylation complex subunit 2UniRule annotation
Gene namesi
Name:Pan2UniRule annotation
Synonyms:Kiaa0710, Usp52
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1918984 Pan2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002805221 – 1200PAN2-PAN3 deadenylation complex catalytic subunit Pan2Add BLAST1200

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei784PhosphoserineCombined sources1
Modified residuei1188PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BGF7
PeptideAtlasiQ8BGF7
PRIDEiQ8BGF7

PTM databases

iPTMnetiQ8BGF7
PhosphoSitePlusiQ8BGF7

Expressioni

Gene expression databases

BgeeiENSMUSG00000005682
GenevisibleiQ8BGF7 MM

Interactioni

Subunit structurei

Forms a heterotrimer with an asymmetric homodimer of the regulatory subunit PAN3 to form the poly(A)-nuclease (PAN) deadenylation complex (By similarity). Interacts with ZFP36 (PubMed:21078877).UniRule annotation1 Publication

Protein-protein interaction databases

BioGridi222025, 1 interactor
IntActiQ8BGF7, 1 interactor
STRINGi10090.ENSMUSP00000005825

Structurei

3D structure databases

ProteinModelPortaliQ8BGF7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati153 – 193WD 1UniRule annotationAdd BLAST41
Repeati195 – 231WD 2UniRule annotationAdd BLAST37
Repeati244 – 280WD 3UniRule annotationAdd BLAST37
Repeati328 – 367WD 4UniRule annotationAdd BLAST40
Domaini485 – 923USPUniRule annotationAdd BLAST439
Domaini974 – 1146ExonucleaseUniRule annotationAdd BLAST173

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni368 – 484LinkerUniRule annotationAdd BLAST117

Domaini

Contains a pseudo-UCH domain. This ubiquitin C-terminal hydrolase (UCH)-like or ubiquitin specific protease (USP)-like domain is predicted to be catalytically inactive because it lacks the active site catalytic triad characteristic of thiol proteases, with residues at the equivalent structural positions that are incompatible with catalysis, and it cannot bind ubiquitin. It functions as a structural scaffold for intra- and intermolecular interactions in the complex.UniRule annotation
The linker, or PAN3 interaction domain (PID), between the WD40 repeats and the pseudo-UCH domain mediates interaction with PAN3.UniRule annotation

Sequence similaritiesi

Belongs to the peptidase C19 family. PAN2 subfamily.UniRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1275 Eukaryota
COG0847 LUCA
GeneTreeiENSGT00390000013978
HOGENOMiHOG000230585
HOVERGENiHBG089847
InParanoidiQ8BGF7
KOiK12571
OMAiIHLWGSP
OrthoDBiEOG091G01KS
PhylomeDBiQ8BGF7
TreeFamiTF105657

Family and domain databases

Gene3Di2.130.10.10, 1 hit
3.30.420.10, 1 hit
HAMAPiMF_03182 PAN2, 1 hit
InterProiView protein in InterPro
IPR013520 Exonuclease_RNaseT/DNA_pol3
IPR030843 PAN2
IPR028881 PAN2_dom
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
IPR028889 USP_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00929 RNase_T, 1 hit
PF13423 UCH_1, 1 hit
SMARTiView protein in SMART
SM00479 EXOIII, 1 hit
SUPFAMiSSF50978 SSF50978, 1 hit
SSF53098 SSF53098, 1 hit
PROSITEiView protein in PROSITE
PS50235 USP_3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BGF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNFEGLDPGL AEFSPAMHST LDPVLDAHLN PSLLQNVELD PEGVALEALP
60 70 80 90 100
VQESVHIMEG VYSELHSVVA EVGVPVSVSH FDLHEEMLWV GSHGGHATSF
110 120 130 140 150
FGPALERYSS FQVNGGDDIR QIQSLENGIL FLTKNNLKYM ARGGLIIFDY
160 170 180 190 200
LLDENEDMHS VLLTDNSTLL VGGLQNHVLE IDLNTVQETQ KYAVETPGVT
210 220 230 240 250
IMRQTNRFFF CGHTSGKVSL RDLRSFKVEH EFDAFSGSLS DFDVHGNLLA
260 270 280 290 300
ACGFSSRLTG LACDRFLKVY DLRMMRAITP LQVHVDPAFL RFIPTYTSRL
310 320 330 340 350
AIISQSGQCQ FCEPTGLANP ADIFHVNPVG PLLMTFDVSA SKQALAFGDS
360 370 380 390 400
EGCVHLWTDS PEPSFNPYSR ETEFALPCLV DSLPPLDWSQ DLLPLSLIPV
410 420 430 440 450
PLTTDALLSD WPAANSAPAP RRAPPVDAEI LRTMKKVGFI GYAPNPRTRL
460 470 480 490 500
RNQIPYRLKE SDHEFDNFSQ VTESPTGREE EPLHTVSKKY RKVTIKYSKL
510 520 530 540 550
GLEDFDFKHY NKTLFAGLEP HIPNAYCNCM IQVLYFLEPV RCLIQNHLCQ
560 570 580 590 600
KEFCLACELG FLFHMLDLSR GDPCQGSNFL RAFRTIPEAS ALGLILADSD
610 620 630 640 650
EASGKGSLAR LIQRWNRFIL TQLHQDMQEL EVPQAYRGAG GSFCSSGDSI
660 670 680 690 700
IGQLFSCEME NCSLCRCGSE TVRASSTLLF TLSYPEDKTG KNYDFAQVLK
710 720 730 740 750
RSICLEQNTQ AWCDNCEKYQ PTIQTRNIRH LPDILVINCE VNSSKEADFW
760 770 780 790 800
RLQAEVAFKI AVKKYGGEMK SKEFALADRK ELRSPEGFLC SSIEELKNVW
810 820 830 840 850
LPFSIRMKMT KNKGLDVCNW ADEHELSSLG APSQWGPARA EEELGVYVYD
860 870 880 890 900
LMATVVHILD SRTGGSLVAH IKVGETYHQR KEGVTHQQWY LFNDFLIEPI
910 920 930 940 950
DKYEAVQFDM NWKVPAILYY VKRNLNSRYN LNIKNPIEAS VLLAEASLAR
960 970 980 990 1000
KQRKTHTTFI PLMLNEMPQV GDLVGLDAEF VTLNEEEAEL RSDGTKSTIK
1010 1020 1030 1040 1050
PSQMSVARIT CVRGQGPNEG IPFIDDYIST QEQVVDYLTQ YSGIKPGDLD
1060 1070 1080 1090 1100
AKISSKHLTT LKSTYLKLRF LIDIGVKFVG HGLQKDFRVI NLMVPKDQVL
1110 1120 1130 1140 1150
DTVYLFHMPR KRMISLRFLA WYFLDLKIQG ETHDSIEDAR TALQLYRKYL
1160 1170 1180 1190 1200
ELSKNGTEPE SFHKVLKGLY EKGRKMDWKV PEPESQTSPK NAAVFSVLAL
Length:1,200
Mass (Da):135,253
Last modified:March 1, 2003 - v1
Checksum:i9CE98D3BE9FCE182
GO
Isoform 2 (identifier: Q8BGF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-834: Missing.

Show »
Length:1,191
Mass (Da):134,413
Checksum:i7EA787D6AEE01B1B
GO
Isoform 3 (identifier: Q8BGF7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-112: Missing.
     826-834: Missing.

Note: No experimental confirmation available.
Show »
Length:1,173
Mass (Da):132,428
Checksum:iFE2477B2C38DDC95
GO
Isoform 4 (identifier: Q8BGF7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-722: DKTGKNYDFAQVLKRSICLEQNTQAWCDNCEKYQPT → GS

Note: No experimental confirmation available.
Show »
Length:1,166
Mass (Da):131,176
Checksum:i7BE7611362D0DC72
GO

Sequence cautioni

The sequence BAC98006 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti175Q → L in BAE34203 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02375095 – 112Missing in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_023751687 – 722DKTGK…KYQPT → GS in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_023752826 – 834Missing in isoform 2 and isoform 3. 2 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129196 Transcribed RNA Translation: BAC98006.2 Different initiation.
AK047887 mRNA Translation: BAC33183.1
AK089001 mRNA Translation: BAC40693.1
AK157800 mRNA Translation: BAE34203.1
BC075686 mRNA Translation: AAH75686.1
BC079841 mRNA Translation: AAH79841.1
CCDSiCCDS24271.1 [Q8BGF7-1]
RefSeqiNP_001239255.1, NM_001252326.1 [Q8BGF7-2]
NP_001239256.1, NM_001252327.1 [Q8BGF7-3]
NP_598753.1, NM_133992.3 [Q8BGF7-1]
UniGeneiMm.244183
Mm.489673

Genome annotation databases

EnsembliENSMUST00000005825; ENSMUSP00000005825; ENSMUSG00000005682 [Q8BGF7-1]
ENSMUST00000218315; ENSMUSP00000151216; ENSMUSG00000005682 [Q8BGF7-2]
ENSMUST00000219721; ENSMUSP00000151874; ENSMUSG00000005682 [Q8BGF7-3]
GeneIDi103135
KEGGimmu:103135
UCSCiuc007hme.2 mouse [Q8BGF7-1]
uc007hmf.2 mouse [Q8BGF7-2]
uc007hmg.2 mouse [Q8BGF7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPAN2_MOUSE
AccessioniPrimary (citable) accession number: Q8BGF7
Secondary accession number(s): Q3TZK5, Q68FH6, Q6ZQ63
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 1, 2003
Last modified: May 23, 2018
This is version 138 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health