Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte-associated immunoglobulin-like receptor 1

Gene

Lair1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosphatases PTPN6 and PTPN11. It also reduces the increase of intracellular calcium evoked by B-cell receptor ligation. May also play its inhibitory role independently of SH2-containing phosphatases. Modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG production while inducing secretion of transforming growth factor beta. Down-regulates also IgG and IgE production in B-cells as well as IL8, IL10 and TNF secretion. Inhibits proliferation and induces apoptosis in myeloid leukemia cell lines as well as prevents nuclear translocation of NF-kappa-B p65 subunit/RELA and phosphorylation of I-kappa-B alpha/CHUK in these cells. Inhibits the differentiation of peripheral blood precursors towards dendritic cells (By similarity).By similarity1 Publication

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiR-MMU-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte-associated immunoglobulin-like receptor 1
Short name:
LAIR-1
Short name:
mLAIR1
Alternative name(s):
CD_antigen: CD305
Gene namesi
Name:Lair1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:105492. Lair1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 144123ExtracellularSequence analysisAdd
BLAST
Transmembranei145 – 16521HelicalSequence analysisAdd
BLAST
Topological domaini166 – 26398CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence analysisAdd
BLAST
Chaini22 – 263242Leukocyte-associated immunoglobulin-like receptor 1PRO_0000250683Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi34 – 341N-linked (GlcNAc...)Sequence analysis
Disulfide bondi49 ↔ 99PROSITE-ProRule annotation
Glycosylationi90 – 901N-linked (GlcNAc...)Sequence analysis
Modified residuei228 – 2281PhosphotyrosineBy similarity
Modified residuei257 – 2571PhosphotyrosineBy similarity

Post-translational modificationi

Phosphorylation at Tyr-228 and Tyr-257 activates it. May be phosphorylated by LCK (By similarity).By similarity
N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8BG84.
PaxDbiQ8BG84.
PRIDEiQ8BG84.

PTM databases

PhosphoSiteiQ8BG84.

Expressioni

Tissue specificityi

Expressed in lymphoid organs and in cell lines of hemopoietic origin.1 Publication

Gene expression databases

BgeeiENSMUSG00000055541.
CleanExiMM_LAIR1.
ExpressionAtlasiQ8BG84. baseline and differential.
GenevisibleiQ8BG84. MM.

Interactioni

Subunit structurei

Interacts with SH2 domains of tyrosine-protein phosphatases PTPN6 and PTPN11. The interaction with PTPN6 is constitutive. Interacts with the SH2 domain of CSK. Binds with high affinity to extracellular matrix collagens, the interaction is functionally important (By similarity).By similarity

Protein-protein interaction databases

DIPiDIP-61634N.
STRINGi10090.ENSMUSP00000083589.

Structurei

Secondary structure

1
263
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi28 – 325Combined sources
Beta strandi35 – 406Combined sources
Beta strandi45 – 506Combined sources
Turni52 – 543Combined sources
Helixi55 – 573Combined sources
Beta strandi60 – 656Combined sources
Beta strandi68 – 747Combined sources
Beta strandi80 – 867Combined sources
Helixi91 – 933Combined sources
Beta strandi95 – 1039Combined sources
Turni104 – 1063Combined sources
Beta strandi107 – 1104Combined sources
Beta strandi114 – 1196Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4ESKX-ray1.76A/B/C/D22-121[»]
4ETYX-ray1.90A/B/C/D22-133[»]
ProteinModelPortaliQ8BG84.
SMRiQ8BG84. Positions 24-121.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 11589Ig-like C2-typeAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi226 – 2316ITIM motif 1
Motifi255 – 2606ITIM motif 2

Domaini

ITIM (immunoreceptor tyrosine-based inhibitor motif) motif is a cytoplasmic motif present in 2 copies in the intracellular part of LAIR1. When phosphorylated, ITIM motif can bind the SH2 domain of several SH2-containing phosphatases, leading to down-regulation of cell activation.1 Publication

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J37Q. Eukaryota.
ENOG41119RI. LUCA.
GeneTreeiENSGT00720000108843.
HOGENOMiHOG000015184.
HOVERGENiHBG081887.
InParanoidiQ8BG84.
KOiK06725.
OMAiRGEQETE.
OrthoDBiEOG091G0TMA.
PhylomeDBiQ8BG84.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BG84-1) [UniParc]FASTAAdd to basket
Also known as: mLair-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLHPVILLV LVLCLGWKIN TQEGSLPDIT IFPNSSLMIS QGTFVTVVCS
60 70 80 90 100
YSDKHDLYNM VRLEKDGSTF MEKSTEPYKT EDEFEIGPVN ETITGHYSCI
110 120 130 140 150
YSKGITWSER SKTLELKVIK ENVIQTPAPG PTSDTSWLKT YSIYIFTVVS
160 170 180 190 200
VIFLLCLSAL LFCFLRHRQK KQGLPNNKRQ QQRPEERLNL ATNGLEMTPD
210 220 230 240 250
IVADDRLPED RWTETWTPVA GDLQEVTYIQ LDHHSLTQRA VGAVTSQSTD
260
MAESSTYAAI IRH
Length:263
Mass (Da):29,793
Last modified:March 1, 2003 - v1
Checksum:iB72D1E170DEF3404
GO
Isoform 2 (identifier: Q8BG84-2) [UniParc]FASTAAdd to basket
Also known as: mLair-1b

The sequence of this isoform differs from the canonical sequence as follows:
     24-133: Missing.

Show »
Length:153
Mass (Da):17,524
Checksum:i366F6A302AC35231
GO
Isoform 3 (identifier: Q8BG84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-56: SLPDITIFPNSSLMISQGTFVTVVCSYSDKHD → ELCLWFLLYPWATLELIMCTWDAWKETLEYFL
     57-263: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:56
Mass (Da):6,701
Checksum:i7DBA62B5CD9DAC98
GO
Isoform 5 (identifier: Q8BG84-5) [UniParc]FASTAAdd to basket
Also known as: mLair-1d

The sequence of this isoform differs from the canonical sequence as follows:
     24-172: Missing.

Show »
Length:114
Mass (Da):12,860
Checksum:i84C686C513D7E57B
GO
Isoform 6 (identifier: Q8BG84-6) [UniParc]FASTAAdd to basket
Also known as: mLair-1e

The sequence of this isoform differs from the canonical sequence as follows:
     134-172: Missing.

Show »
Length:224
Mass (Da):25,128
Checksum:iDF3A2399EEE324DA
GO

Sequence cautioni

The sequence BAC25505 differs from that shown. Reason: Frameshift at position 252. Curated
The sequence BAC31610 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence BAC35674 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti143 – 1453IYI → MYM in BAC25505 (PubMed:16141072).Curated
Sequence conflicti149 – 1491V → G in BAC25505 (PubMed:16141072).Curated
Sequence conflicti154 – 1541L → P in BAC25505 (PubMed:16141072).Curated
Sequence conflicti263 – 2631H → R in AAH25901 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei24 – 172149Missing in isoform 5. 1 PublicationVSP_020715Add
BLAST
Alternative sequencei24 – 133110Missing in isoform 2. 2 PublicationsVSP_020716Add
BLAST
Alternative sequencei25 – 5632SLPDI…SDKHD → ELCLWFLLYPWATLELIMCT WDAWKETLEYFL in isoform 3. 1 PublicationVSP_020714Add
BLAST
Alternative sequencei57 – 263207Missing in isoform 3. 1 PublicationVSP_020719Add
BLAST
Alternative sequencei134 – 17239Missing in isoform 6. 1 PublicationVSP_020718Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY392763 mRNA. Translation: AAR32125.1.
AY392764 mRNA. Translation: AAR32126.1.
AY392765 mRNA. Translation: AAR32127.1.
AY392766 mRNA. Translation: AAR32128.1.
AK017222 mRNA. Translation: BAC25505.1. Frameshift.
AK033472 mRNA. Translation: BAC28306.1.
AK038574 mRNA. Translation: BAC30051.1.
AK043664 mRNA. Translation: BAC31610.1. Sequence problems.
AK044465 mRNA. Translation: BAC31936.1.
AK050281 mRNA. Translation: BAC34164.1.
AK054158 mRNA. Translation: BAC35674.1. Sequence problems.
BC025901 mRNA. Translation: AAH25901.1.
CCDSiCCDS20729.1. [Q8BG84-2]
CCDS51969.1. [Q8BG84-1]
CCDS80654.1. [Q8BG84-6]
RefSeqiNP_001106945.1. NM_001113474.1. [Q8BG84-1]
NP_001289604.1. NM_001302675.1. [Q8BG84-6]
NP_001289605.1. NM_001302676.1.
NP_001289606.1. NM_001302677.1. [Q8BG84-5]
NP_001289610.1. NM_001302681.1.
NP_001289611.1. NM_001302682.1.
NP_001289612.1. NM_001302683.1.
NP_848726.1. NM_178611.6. [Q8BG84-2]
XP_006540238.1. XM_006540175.2. [Q8BG84-1]
XP_006540239.1. XM_006540176.2. [Q8BG84-1]
UniGeneiMm.290880.

Genome annotation databases

EnsembliENSMUST00000068865; ENSMUSP00000070712; ENSMUSG00000055541. [Q8BG84-2]
ENSMUST00000086401; ENSMUSP00000083589; ENSMUSG00000055541. [Q8BG84-1]
ENSMUST00000108600; ENSMUSP00000104241; ENSMUSG00000055541. [Q8BG84-6]
ENSMUST00000131126; ENSMUSP00000121738; ENSMUSG00000055541. [Q8BG84-3]
ENSMUST00000136616; ENSMUSP00000122037; ENSMUSG00000055541. [Q8BG84-3]
ENSMUST00000149395; ENSMUSP00000116800; ENSMUSG00000055541. [Q8BG84-3]
ENSMUST00000205296; ENSMUSP00000145940; ENSMUSG00000055541. [Q8BG84-5]
GeneIDi52855.
KEGGimmu:52855.
UCSCiuc009ews.2. mouse. [Q8BG84-2]
uc009ewt.2. mouse. [Q8BG84-1]
uc012ewk.1. mouse. [Q8BG84-5]
uc012ewl.1. mouse. [Q8BG84-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY392763 mRNA. Translation: AAR32125.1.
AY392764 mRNA. Translation: AAR32126.1.
AY392765 mRNA. Translation: AAR32127.1.
AY392766 mRNA. Translation: AAR32128.1.
AK017222 mRNA. Translation: BAC25505.1. Frameshift.
AK033472 mRNA. Translation: BAC28306.1.
AK038574 mRNA. Translation: BAC30051.1.
AK043664 mRNA. Translation: BAC31610.1. Sequence problems.
AK044465 mRNA. Translation: BAC31936.1.
AK050281 mRNA. Translation: BAC34164.1.
AK054158 mRNA. Translation: BAC35674.1. Sequence problems.
BC025901 mRNA. Translation: AAH25901.1.
CCDSiCCDS20729.1. [Q8BG84-2]
CCDS51969.1. [Q8BG84-1]
CCDS80654.1. [Q8BG84-6]
RefSeqiNP_001106945.1. NM_001113474.1. [Q8BG84-1]
NP_001289604.1. NM_001302675.1. [Q8BG84-6]
NP_001289605.1. NM_001302676.1.
NP_001289606.1. NM_001302677.1. [Q8BG84-5]
NP_001289610.1. NM_001302681.1.
NP_001289611.1. NM_001302682.1.
NP_001289612.1. NM_001302683.1.
NP_848726.1. NM_178611.6. [Q8BG84-2]
XP_006540238.1. XM_006540175.2. [Q8BG84-1]
XP_006540239.1. XM_006540176.2. [Q8BG84-1]
UniGeneiMm.290880.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4ESKX-ray1.76A/B/C/D22-121[»]
4ETYX-ray1.90A/B/C/D22-133[»]
ProteinModelPortaliQ8BG84.
SMRiQ8BG84. Positions 24-121.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-61634N.
STRINGi10090.ENSMUSP00000083589.

PTM databases

PhosphoSiteiQ8BG84.

Proteomic databases

MaxQBiQ8BG84.
PaxDbiQ8BG84.
PRIDEiQ8BG84.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000068865; ENSMUSP00000070712; ENSMUSG00000055541. [Q8BG84-2]
ENSMUST00000086401; ENSMUSP00000083589; ENSMUSG00000055541. [Q8BG84-1]
ENSMUST00000108600; ENSMUSP00000104241; ENSMUSG00000055541. [Q8BG84-6]
ENSMUST00000131126; ENSMUSP00000121738; ENSMUSG00000055541. [Q8BG84-3]
ENSMUST00000136616; ENSMUSP00000122037; ENSMUSG00000055541. [Q8BG84-3]
ENSMUST00000149395; ENSMUSP00000116800; ENSMUSG00000055541. [Q8BG84-3]
ENSMUST00000205296; ENSMUSP00000145940; ENSMUSG00000055541. [Q8BG84-5]
GeneIDi52855.
KEGGimmu:52855.
UCSCiuc009ews.2. mouse. [Q8BG84-2]
uc009ewt.2. mouse. [Q8BG84-1]
uc012ewk.1. mouse. [Q8BG84-5]
uc012ewl.1. mouse. [Q8BG84-6]

Organism-specific databases

CTDi3903.
MGIiMGI:105492. Lair1.

Phylogenomic databases

eggNOGiENOG410J37Q. Eukaryota.
ENOG41119RI. LUCA.
GeneTreeiENSGT00720000108843.
HOGENOMiHOG000015184.
HOVERGENiHBG081887.
InParanoidiQ8BG84.
KOiK06725.
OMAiRGEQETE.
OrthoDBiEOG091G0TMA.
PhylomeDBiQ8BG84.

Enzyme and pathway databases

ReactomeiR-MMU-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

PROiQ8BG84.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000055541.
CleanExiMM_LAIR1.
ExpressionAtlasiQ8BG84. baseline and differential.
GenevisibleiQ8BG84. MM.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLAIR1_MOUSE
AccessioniPrimary (citable) accession number: Q8BG84
Secondary accession number(s): Q80UN5
, Q8BHB6, Q8BRR6, Q8C6N8, Q8CEP5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.