Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein EFR3 homolog A

Gene

Efr3a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane. The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns4P) synthesis. In the complex, EFR3A probably acts as the membrane-anchoring component. Also involved in responsiveness to G-protein-coupled receptors; it is however unclear whether this role is direct or indirect.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein EFR3 homolog ACurated
Alternative name(s):
Protein EFR3-like
Gene namesi
Name:Efr3aImported
Synonyms:Kiaa01431 Publication
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1923990. Efr3a.

Subcellular locationi

  • Cell membrane 1 Publication; Lipid-anchor By similarity
  • Cytoplasmcytosol By similarity

  • Note: Palmitoylation anchors the protein to the plasma membrane. A small amount is observed in the cytosol.By similarity

GO - Cellular componenti

  • cornified envelope Source: MGI
  • cytosol Source: UniProtKB-SubCell
  • extracellular exosome Source: MGI
  • intracellular Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 819819Protein EFR3 homolog APRO_0000270766Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei360 – 3601PhosphoserineCombined sources
Modified residuei363 – 3631PhosphoserineCombined sources
Modified residuei420 – 4201PhosphoserineBy similarity
Modified residuei692 – 6921PhosphoserineCombined sources

Post-translational modificationi

Palmitoylated at its N-terminus, anchoring the protein to the plasma membrane.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ8BG67.
MaxQBiQ8BG67.
PaxDbiQ8BG67.
PeptideAtlasiQ8BG67.
PRIDEiQ8BG67.

PTM databases

iPTMnetiQ8BG67.
PhosphoSiteiQ8BG67.
SwissPalmiQ8BG67.

Expressioni

Tissue specificityi

Widely expressed (PubMed:25380825). Expressed in neurons of the superior olivary complex of the auditory brainstem. Also expressed at lower levels in the cochlear nucleus, the lateral leminiscal nuclei and the inferior collicus (PubMed:15363888).2 Publications

Inductioni

Expression is reduced in animals with impaired hearing.1 Publication

Gene expression databases

BgeeiENSMUSG00000015002.
CleanExiMM_EFR3A.
ExpressionAtlasiQ8BG67. baseline and differential.
GenevisibleiQ8BG67. MM.

Interactioni

Subunit structurei

Component of a phosphatidylinositol 4-kinase (PI4K) complex, composed of PI4KA, EFR3 (EFR3A or EFR3B), TTC7 (TTC7A or TTC7B) and FAM126 (FAM126A or FAM126B).By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ8BG67. 1 interaction.
STRINGi10090.ENSMUSP00000015146.

Structurei

3D structure databases

ProteinModelPortaliQ8BG67.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the EFR3 family.Curated

Phylogenomic databases

eggNOGiKOG1877. Eukaryota.
ENOG410YJSK. LUCA.
GeneTreeiENSGT00390000002143.
HOGENOMiHOG000007148.
HOVERGENiHBG060233.
InParanoidiQ8BG67.
OMAiCCCAALR.
OrthoDBiEOG091G01LS.
PhylomeDBiQ8BG67.
TreeFamiTF314098.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BG67-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPTRVCCCCS ALRPRYKRLV DNIFPEDPKD GLVKADMEKL TFYAVSAPEK
60 70 80 90 100
LDRIGAYLAE RLSRDVVRHR SGYVLIAMEA LDQLLMACHS QSIKPFVESF
110 120 130 140 150
LHMVAKLLES GEPKLQVLGT NSFVKFANIE EDTPSYHRRY DFFVSRFSAM
160 170 180 190 200
CHSCHSDPEI RTEIRIAGIR GIQGVVRKTV NDELRATIWE PQHMDKIVPS
210 220 230 240 250
LLFNMQKIEE VDSRLGPPSS PSAADKEENP AVLAESCFRE LLGRATFGNM
260 270 280 290 300
NNAVRPVFAH LDHHKLWDPN EFAVHCFKII MYSIQAQYSH HVIQEILGHL
310 320 330 340 350
DARRKDSPRV RAGIIQVLLE AVAIAAKGSI GPTVLEVFNT LLKHLRLSVE
360 370 380 390 400
LEANDSQKGS VGSVTVSSKD NDEKIVQNAV IQTIGFFGSN LPDYQRSEIM
410 420 430 440 450
MFIMGKVPVF GTSTHTLDIS QLGDLGTRRI QIMLLRSLLM VTSGYKAKTI
460 470 480 490 500
VTALPGSFLD PLLSPSLMED YELRQLVLEV MHNLMDRHDN RAKLRGIRII
510 520 530 540 550
PDVADLKIKR EKICRQDTSF MKKNGQQLYR HIYLGCKEED NVQKNYELLY
560 570 580 590 600
TSLALITIEL ANEEVVIDLI RLAIALQDSA IINEDNLSMF HRCGIMALVA
610 620 630 640 650
AYLNFVSQMI AVPAFCQHVS KVIETRTMEA PYFLPEHIFR DKCMLPKSLE
660 670 680 690 700
KHDKNLYFLT NKIAESLGGS GYSVERLTVP YVPQVTDEDR LSRRKSIVDT
710 720 730 740 750
VSIQVDILSN SVPSDDVVSN TEEITFEALK KAIDTNGMEE QEKEKRRLVI
760 770 780 790 800
EKFQKAPFEE IAAQCESKAN LLHDRLAQIL ELTIRPPPSP SGTLTVTSGH
810
TQYQSVPVYE MKFPDLCVY
Length:819
Mass (Da):92,613
Last modified:March 1, 2003 - v1
Checksum:iBF3BCD87C508CD1A
GO
Isoform 2 (identifier: Q8BG67-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     786-819: PPPSPSGTLTVTSGHTQYQSVPVYEMKFPDLCVY → QRRESMLYKTEAEPCYTQPMAWGQRRIKEKYKAVVK

Note: No experimental confirmation available.
Show »
Length:821
Mass (Da):93,290
Checksum:iC328144EEC21F3AA
GO

Sequence cautioni

The sequence BAC97875 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 701R → H in BAC31942 (PubMed:16141072).Curated
Sequence conflicti364 – 3641V → I in AAH07482 (PubMed:15489334).Curated
Sequence conflicti585 – 5851D → G in BAC31942 (PubMed:16141072).Curated
Sequence conflicti693 – 6931R → T in BAC26768 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei786 – 81934PPPSP…DLCVY → QRRESMLYKTEAEPCYTQPM AWGQRRIKEKYKAVVK in isoform 2. 1 PublicationVSP_022219Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB158474 mRNA. Translation: BAD52086.1.
AK129065 mRNA. Translation: BAC97875.1. Different initiation.
AK030074 mRNA. Translation: BAC26768.1.
AK032461 mRNA. Translation: BAC27881.1.
AK044000 mRNA. Translation: BAC31732.1.
AK044475 mRNA. Translation: BAC31942.1.
AK161250 mRNA. Translation: BAE36269.1.
BC007482 mRNA. Translation: AAH07482.1.
CCDSiCCDS27507.1. [Q8BG67-1]
RefSeqiNP_598527.2. NM_133766.3. [Q8BG67-1]
UniGeneiMm.260647.

Genome annotation databases

EnsembliENSMUST00000015146; ENSMUSP00000015146; ENSMUSG00000015002. [Q8BG67-1]
ENSMUST00000173858; ENSMUSP00000134385; ENSMUSG00000015002. [Q8BG67-2]
GeneIDi76740.
KEGGimmu:76740.
UCSCiuc007vzu.1. mouse. [Q8BG67-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB158474 mRNA. Translation: BAD52086.1.
AK129065 mRNA. Translation: BAC97875.1. Different initiation.
AK030074 mRNA. Translation: BAC26768.1.
AK032461 mRNA. Translation: BAC27881.1.
AK044000 mRNA. Translation: BAC31732.1.
AK044475 mRNA. Translation: BAC31942.1.
AK161250 mRNA. Translation: BAE36269.1.
BC007482 mRNA. Translation: AAH07482.1.
CCDSiCCDS27507.1. [Q8BG67-1]
RefSeqiNP_598527.2. NM_133766.3. [Q8BG67-1]
UniGeneiMm.260647.

3D structure databases

ProteinModelPortaliQ8BG67.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BG67. 1 interaction.
STRINGi10090.ENSMUSP00000015146.

PTM databases

iPTMnetiQ8BG67.
PhosphoSiteiQ8BG67.
SwissPalmiQ8BG67.

Proteomic databases

EPDiQ8BG67.
MaxQBiQ8BG67.
PaxDbiQ8BG67.
PeptideAtlasiQ8BG67.
PRIDEiQ8BG67.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000015146; ENSMUSP00000015146; ENSMUSG00000015002. [Q8BG67-1]
ENSMUST00000173858; ENSMUSP00000134385; ENSMUSG00000015002. [Q8BG67-2]
GeneIDi76740.
KEGGimmu:76740.
UCSCiuc007vzu.1. mouse. [Q8BG67-1]

Organism-specific databases

CTDi23167.
MGIiMGI:1923990. Efr3a.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1877. Eukaryota.
ENOG410YJSK. LUCA.
GeneTreeiENSGT00390000002143.
HOGENOMiHOG000007148.
HOVERGENiHBG060233.
InParanoidiQ8BG67.
OMAiCCCAALR.
OrthoDBiEOG091G01LS.
PhylomeDBiQ8BG67.
TreeFamiTF314098.

Miscellaneous databases

PROiQ8BG67.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000015002.
CleanExiMM_EFR3A.
ExpressionAtlasiQ8BG67. baseline and differential.
GenevisibleiQ8BG67. MM.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiEFR3A_MOUSE
AccessioniPrimary (citable) accession number: Q8BG67
Secondary accession number(s): Q6ZQI4
, Q8BXQ7, Q8C0Q0, Q922I2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: March 1, 2003
Last modified: September 7, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.