Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial Rho GTPase 1

Gene

Rhot1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi24 – 318GTP 1Sequence analysis
Nucleotide bindingi70 – 745GTP 1Sequence analysis
Nucleotide bindingi131 – 1344GTP 1Sequence analysis
Calcium bindingi210 – 221121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi330 – 341122PROSITE-ProRule annotationAdd
BLAST
Nucleotide bindingi438 – 4458GTP 2Sequence analysis
Nucleotide bindingi476 – 4805GTP 2Sequence analysis
Nucleotide bindingi540 – 5434GTP 2Sequence analysis

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calcium, GTP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial Rho GTPase 1 (EC:3.6.5.-)
Short name:
MIRO-1
Alternative name(s):
Ras homolog gene family member T1
Gene namesi
Name:Rhot1
Synonyms:Arht1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1926078. Rhot1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 605605Mitochondrial intermembraneSequence analysisAdd
BLAST
Transmembranei606 – 62823Helical; Anchor for type IV membrane proteinSequence analysisAdd
BLAST
Topological domaini629 – 6313CytoplasmicSequence analysis

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 631631Mitochondrial Rho GTPase 1PRO_0000239314Add
BLAST

Post-translational modificationi

Ubiquitinated by PARK2 during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30 (By similarity).By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ8BG51.
MaxQBiQ8BG51.
PeptideAtlasiQ8BG51.
PRIDEiQ8BG51.

PTM databases

iPTMnetiQ8BG51.
PhosphoSiteiQ8BG51.

Expressioni

Gene expression databases

BgeeiQ8BG51.
CleanExiMM_RHOT1.
ExpressionAtlasiQ8BG51. baseline and differential.
GenevisibleiQ8BG51. MM.

Interactioni

Subunit structurei

Interacts with the kinesin-binding proteins TRAK1/OIP106 and TRAK2/GRIF1, forming a link between mitochondria and the trafficking apparatus of the microtubules.By similarity

Protein-protein interaction databases

BioGridi208504. 1 interaction.
IntActiQ8BG51. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8BG51.
SMRiQ8BG51. Positions 18-594.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini11 – 190180Miro 1Add
BLAST
Domaini197 – 23236EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini317 – 35236EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini425 – 574150Miro 2Add
BLAST

Sequence similaritiesi

Belongs to the mitochondrial Rho GTPase family.Curated
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 2 Miro domains.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000014374.
HOVERGENiHBG079778.
InParanoidiQ8BG51.
KOiK07870.
OMAiAIMEDYP.
OrthoDBiEOG7PK8Z0.
PhylomeDBiQ8BG51.
TreeFamiTF300814.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
3.40.50.300. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR013566. EF_hand_assoc_1.
IPR013567. EF_hand_assoc_2.
IPR002048. EF_hand_dom.
IPR020860. MIRO_dom.
IPR021181. Mt_Rho_GTPase.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF08355. EF_assoc_1. 1 hit.
PF08356. EF_assoc_2. 1 hit.
PF00071. Ras. 2 hits.
[Graphical view]
PIRSFiPIRSF037488. Mt_Rho_GTPase. 1 hit.
SUPFAMiSSF47473. SSF47473. 2 hits.
SSF52540. SSF52540. 2 hits.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS51423. MIRO. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BG51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRAGRVRPLR ASDMKKDVRI LLVGEPRVGK TSLIMSLVSE EFPEEVPPRA
60 70 80 90 100
EEITIPADVT PERVPTHIVD YSEAEQSDEQ LHQEISQANV ICIVYAVNNK
110 120 130 140 150
HSIDKVTSRW IPLINERTDK DSRLPLILVG NKSDLVEYSS METILPIMNQ
160 170 180 190 200
YTEIETCVEC SAKNLKNISE LFYYAQKAVL HPTGPLYCPE EKEMKPACIK
210 220 230 240 250
ALTRIFKISD QDNDGTLNDA ELNFFQRICF NTPLAPQALE DVKNVVRKHL
260 270 280 290 300
SDGVADSGLT LRGFLFLHTL FIQRGRHETT WTVLRRFGYD DDLDLTPEYL
310 320 330 340 350
FPLLKIPPDC TTELNHHAYL FLQSTFDKHD LDRDCALSPD ELKDLFQVFP
360 370 380 390 400
YIPWGPDVNN TVCTNERGWI TYQGFLSQWT LTTYLDVQRC LEYLGYLGYS
410 420 430 440 450
ILTEQESQAS AITVTRDKKI DLQKKQTQRN VFRCNVIGVK GCGKTGVLQS
460 470 480 490 500
LLGRNLMRQK KIRDDHKSYY AINTVYVYGQ EKYLLLHDIS ESEFLTEAET
510 520 530 540 550
ICDVVCLVYD VTNPKSFEYC ARIFKQHFMD SRIPCLIVAA KSDLHEVKQE
560 570 580 590 600
HSISPTDFCR KHKMPPPQAF TCNTADAPSK DIFVKLTTMA MYPHVTQADL
610 620 630
KSSTFWLRAS FGATVFAVVG FAMYRALLKQ R
Length:631
Mass (Da):72,242
Last modified:March 1, 2003 - v1
Checksum:iC6B1BA3DDE904DF3
GO
Isoform 2 (identifier: Q8BG51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: P → PEDHYRGSLSRDMGSTDRIENLRKIWVFLKTAL

Show »
Length:663
Mass (Da):76,032
Checksum:iF77333BF7CD190CF
GO
Isoform 3 (identifier: Q8BG51-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: P → PHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:672
Mass (Da):77,003
Checksum:i812B2F5BF0128BB9
GO
Isoform 4 (identifier: Q8BG51-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: P → PEDHYRGSLSRDMGSTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:704
Mass (Da):80,828
Checksum:i1249311424BD0528
GO

Sequence cautioni

The sequence AAF64187.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC27274.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAI25296.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti263 – 2631G → D in BAC30828 (PubMed:16141072).Curated
Sequence conflicti419 – 4191K → Q in AAF64187 (Ref. 4) Curated
Sequence conflicti442 – 4421C → F in BAB31529 (PubMed:16141072).Curated
Sequence conflicti572 – 5721C → S in BAC27274 (PubMed:16141072).Curated
Isoform 2 (identifier: Q8BG51-2)
Sequence conflicti593 – 5931P → T in BAE28113 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei593 – 5931P → PEDHYRGSLSRDMGSTDRIE NLRKIWVFLKTAL in isoform 2. 1 PublicationVSP_019159
Alternative sequencei593 – 5931P → PHARLRCMCTCNRCTFCICQ NFLNSDLLQSVKNKIFTAVL NR in isoform 3. 2 PublicationsVSP_019160
Alternative sequencei593 – 5931P → PEDHYRGSLSRDMGSTDRIE NLRKIWVFLKTAFHARLRCM CTCNRCTFCICQNFLNSDLL QSVKNKIFTAVLNR in isoform 4. CuratedVSP_019161

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019059 mRNA. Translation: BAB31529.2.
AK028597 mRNA. Translation: BAC26025.1.
AK031139 mRNA. Translation: BAC27274.1. Different initiation.
AK041119 mRNA. Translation: BAC30828.1.
AK054472 mRNA. Translation: BAC35792.1.
AK078955 mRNA. Translation: BAC37478.1.
AK138830 mRNA. Translation: BAE23792.1.
AK141621 mRNA. Translation: BAE24771.1.
AK147749 mRNA. Translation: BAE28113.1.
AK147801 mRNA. Translation: BAE28148.1.
AK167502 mRNA. Translation: BAE39578.1.
AL591426 Genomic DNA. Translation: CAI25293.1.
AL591426 Genomic DNA. Translation: CAI25294.1.
AL591426 Genomic DNA. Translation: CAI25295.1.
AL591426 Genomic DNA. Translation: CAI25296.1. Sequence problems.
BC006918 mRNA. Translation: AAH06918.1.
BC046785 mRNA. Translation: AAH46785.1.
BC058350 mRNA. Translation: AAH58350.1.
AF244542 mRNA. Translation: AAF64187.1. Different initiation.
CCDSiCCDS25130.1. [Q8BG51-1]
CCDS48861.1. [Q8BG51-2]
CCDS48862.1. [Q8BG51-3]
RefSeqiNP_001156826.1. NM_001163354.1. [Q8BG51-2]
NP_001156827.1. NM_001163355.1. [Q8BG51-3]
NP_067511.4. NM_021536.7. [Q8BG51-1]
XP_011247470.1. XM_011249168.1. [Q8BG51-4]
UniGeneiMm.489674.

Genome annotation databases

EnsembliENSMUST00000017831; ENSMUSP00000017831; ENSMUSG00000017686. [Q8BG51-2]
ENSMUST00000055056; ENSMUSP00000057669; ENSMUSG00000017686. [Q8BG51-3]
ENSMUST00000077451; ENSMUSP00000076664; ENSMUSG00000017686. [Q8BG51-4]
ENSMUST00000092857; ENSMUSP00000090533; ENSMUSG00000017686. [Q8BG51-1]
GeneIDi59040.
KEGGimmu:59040.
UCSCiuc007klo.2. mouse. [Q8BG51-1]
uc007klp.2. mouse. [Q8BG51-2]
uc007klq.2. mouse. [Q8BG51-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019059 mRNA. Translation: BAB31529.2.
AK028597 mRNA. Translation: BAC26025.1.
AK031139 mRNA. Translation: BAC27274.1. Different initiation.
AK041119 mRNA. Translation: BAC30828.1.
AK054472 mRNA. Translation: BAC35792.1.
AK078955 mRNA. Translation: BAC37478.1.
AK138830 mRNA. Translation: BAE23792.1.
AK141621 mRNA. Translation: BAE24771.1.
AK147749 mRNA. Translation: BAE28113.1.
AK147801 mRNA. Translation: BAE28148.1.
AK167502 mRNA. Translation: BAE39578.1.
AL591426 Genomic DNA. Translation: CAI25293.1.
AL591426 Genomic DNA. Translation: CAI25294.1.
AL591426 Genomic DNA. Translation: CAI25295.1.
AL591426 Genomic DNA. Translation: CAI25296.1. Sequence problems.
BC006918 mRNA. Translation: AAH06918.1.
BC046785 mRNA. Translation: AAH46785.1.
BC058350 mRNA. Translation: AAH58350.1.
AF244542 mRNA. Translation: AAF64187.1. Different initiation.
CCDSiCCDS25130.1. [Q8BG51-1]
CCDS48861.1. [Q8BG51-2]
CCDS48862.1. [Q8BG51-3]
RefSeqiNP_001156826.1. NM_001163354.1. [Q8BG51-2]
NP_001156827.1. NM_001163355.1. [Q8BG51-3]
NP_067511.4. NM_021536.7. [Q8BG51-1]
XP_011247470.1. XM_011249168.1. [Q8BG51-4]
UniGeneiMm.489674.

3D structure databases

ProteinModelPortaliQ8BG51.
SMRiQ8BG51. Positions 18-594.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi208504. 1 interaction.
IntActiQ8BG51. 2 interactions.

PTM databases

iPTMnetiQ8BG51.
PhosphoSiteiQ8BG51.

Proteomic databases

EPDiQ8BG51.
MaxQBiQ8BG51.
PeptideAtlasiQ8BG51.
PRIDEiQ8BG51.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000017831; ENSMUSP00000017831; ENSMUSG00000017686. [Q8BG51-2]
ENSMUST00000055056; ENSMUSP00000057669; ENSMUSG00000017686. [Q8BG51-3]
ENSMUST00000077451; ENSMUSP00000076664; ENSMUSG00000017686. [Q8BG51-4]
ENSMUST00000092857; ENSMUSP00000090533; ENSMUSG00000017686. [Q8BG51-1]
GeneIDi59040.
KEGGimmu:59040.
UCSCiuc007klo.2. mouse. [Q8BG51-1]
uc007klp.2. mouse. [Q8BG51-2]
uc007klq.2. mouse. [Q8BG51-3]

Organism-specific databases

CTDi55288.
MGIiMGI:1926078. Rhot1.

Phylogenomic databases

GeneTreeiENSGT00390000014374.
HOVERGENiHBG079778.
InParanoidiQ8BG51.
KOiK07870.
OMAiAIMEDYP.
OrthoDBiEOG7PK8Z0.
PhylomeDBiQ8BG51.
TreeFamiTF300814.

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSiRhot1. mouse.
PROiQ8BG51.
SOURCEiSearch...

Gene expression databases

BgeeiQ8BG51.
CleanExiMM_RHOT1.
ExpressionAtlasiQ8BG51. baseline and differential.
GenevisibleiQ8BG51. MM.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
3.40.50.300. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR013566. EF_hand_assoc_1.
IPR013567. EF_hand_assoc_2.
IPR002048. EF_hand_dom.
IPR020860. MIRO_dom.
IPR021181. Mt_Rho_GTPase.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF08355. EF_assoc_1. 1 hit.
PF08356. EF_assoc_2. 1 hit.
PF00071. Ras. 2 hits.
[Graphical view]
PIRSFiPIRSF037488. Mt_Rho_GTPase. 1 hit.
SUPFAMiSSF47473. SSF47473. 2 hits.
SSF52540. SSF52540. 2 hits.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS51423. MIRO. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Aorta, Cecum, Forelimb, Ovary, Skin, Stomach, Thymus and Vein.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 4).
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 240-633 (ISOFORM 3).
    Strain: C57BL/6J and FVB/N.
    Tissue: Brain and Mammary tumor.
  4. "LNAME-inducible ANA-1 cells mRNA expression."
    Guo H., Cai Q., Schroeder R., Kuo P.C.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 392-631.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiMIRO1_MOUSE
AccessioniPrimary (citable) accession number: Q8BG51
Secondary accession number(s): Q3TJB7
, Q3UGU4, Q5SYC3, Q5SYC6, Q8BLW3, Q8BMH1, Q922N0, Q9D2R1, Q9JKB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: March 1, 2003
Last modified: July 6, 2016
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.