Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial Rho GTPase 1

Gene

Rhot1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi24 – 31GTP 1Sequence analysis8
Nucleotide bindingi70 – 74GTP 1Sequence analysis5
Nucleotide bindingi131 – 134GTP 1Sequence analysis4
Calcium bindingi210 – 2211PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi330 – 3412PROSITE-ProRule annotationAdd BLAST12
Nucleotide bindingi438 – 445GTP 2Sequence analysis8
Nucleotide bindingi476 – 480GTP 2Sequence analysis5
Nucleotide bindingi540 – 543GTP 2Sequence analysis4

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandCalcium, GTP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-194840 Rho GTPase cycle
R-MMU-5689880 Ub-specific processing proteases

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial Rho GTPase 1 (EC:3.6.5.-)
Short name:
MIRO-1
Alternative name(s):
Ras homolog gene family member T1
Gene namesi
Name:Rhot1
Synonyms:Arht1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1926078 Rhot1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 605Mitochondrial intermembraneSequence analysisAdd BLAST605
Transmembranei606 – 628Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST23
Topological domaini629 – 631CytoplasmicSequence analysis3

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002393141 – 631Mitochondrial Rho GTPase 1Add BLAST631

Post-translational modificationi

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30 (By similarity).By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ8BG51
PeptideAtlasiQ8BG51
PRIDEiQ8BG51

PTM databases

iPTMnetiQ8BG51
PhosphoSitePlusiQ8BG51
SwissPalmiQ8BG51

Expressioni

Gene expression databases

BgeeiENSMUSG00000017686
CleanExiMM_RHOT1
ExpressionAtlasiQ8BG51 baseline and differential
GenevisibleiQ8BG51 MM

Interactioni

Subunit structurei

Interacts with the kinesin-binding proteins TRAK1/OIP106 and TRAK2/GRIF1, forming a link between mitochondria and the trafficking apparatus of the microtubules (By similarity). Interacts with ARMCX1 (PubMed:28009275). Found in a complex with KIF5B, OGT, RHOT2 and TRAK1 (By similarity).By similarity1 Publication

Protein-protein interaction databases

BioGridi208504, 2 interactors
IntActiQ8BG51, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliQ8BG51
SMRiQ8BG51
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 190Miro 1Add BLAST180
Domaini197 – 232EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini317 – 352EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini425 – 574Miro 2Add BLAST150

Sequence similaritiesi

Belongs to the mitochondrial Rho GTPase family.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000014374
HOVERGENiHBG079778
InParanoidiQ8BG51
KOiK07870
OMAiKGRHETI
OrthoDBiEOG091G04UF
PhylomeDBiQ8BG51
TreeFamiTF300814

Family and domain databases

InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR013566 EF_hand_assoc_1
IPR013567 EF_hand_assoc_2
IPR002048 EF_hand_dom
IPR021181 Miro
IPR020860 MIRO_dom
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF08355 EF_assoc_1, 1 hit
PF08356 EF_assoc_2, 1 hit
PF00071 Ras, 2 hits
PIRSFiPIRSF037488 Mt_Rho_GTPase, 1 hit
SUPFAMiSSF47473 SSF47473, 2 hits
SSF52540 SSF52540, 2 hits
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS51423 MIRO, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8BG51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRAGRVRPLR ASDMKKDVRI LLVGEPRVGK TSLIMSLVSE EFPEEVPPRA
60 70 80 90 100
EEITIPADVT PERVPTHIVD YSEAEQSDEQ LHQEISQANV ICIVYAVNNK
110 120 130 140 150
HSIDKVTSRW IPLINERTDK DSRLPLILVG NKSDLVEYSS METILPIMNQ
160 170 180 190 200
YTEIETCVEC SAKNLKNISE LFYYAQKAVL HPTGPLYCPE EKEMKPACIK
210 220 230 240 250
ALTRIFKISD QDNDGTLNDA ELNFFQRICF NTPLAPQALE DVKNVVRKHL
260 270 280 290 300
SDGVADSGLT LRGFLFLHTL FIQRGRHETT WTVLRRFGYD DDLDLTPEYL
310 320 330 340 350
FPLLKIPPDC TTELNHHAYL FLQSTFDKHD LDRDCALSPD ELKDLFQVFP
360 370 380 390 400
YIPWGPDVNN TVCTNERGWI TYQGFLSQWT LTTYLDVQRC LEYLGYLGYS
410 420 430 440 450
ILTEQESQAS AITVTRDKKI DLQKKQTQRN VFRCNVIGVK GCGKTGVLQS
460 470 480 490 500
LLGRNLMRQK KIRDDHKSYY AINTVYVYGQ EKYLLLHDIS ESEFLTEAET
510 520 530 540 550
ICDVVCLVYD VTNPKSFEYC ARIFKQHFMD SRIPCLIVAA KSDLHEVKQE
560 570 580 590 600
HSISPTDFCR KHKMPPPQAF TCNTADAPSK DIFVKLTTMA MYPHVTQADL
610 620 630
KSSTFWLRAS FGATVFAVVG FAMYRALLKQ R
Length:631
Mass (Da):72,242
Last modified:March 1, 2003 - v1
Checksum:iC6B1BA3DDE904DF3
GO
Isoform 2 (identifier: Q8BG51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: P → PEDHYRGSLSRDMGSTDRIENLRKIWVFLKTAL

Show »
Length:663
Mass (Da):76,032
Checksum:iF77333BF7CD190CF
GO
Isoform 3 (identifier: Q8BG51-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: P → PHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:672
Mass (Da):77,003
Checksum:i812B2F5BF0128BB9
GO
Isoform 4 (identifier: Q8BG51-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-593: P → PEDHYRGSLSRDMGSTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:704
Mass (Da):80,828
Checksum:i1249311424BD0528
GO

Sequence cautioni

The sequence AAF64187 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC27274 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI25296 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti263G → D in BAC30828 (PubMed:16141072).Curated1
Sequence conflicti419K → Q in AAF64187 (Ref. 4) Curated1
Sequence conflicti442C → F in BAB31529 (PubMed:16141072).Curated1
Sequence conflicti572C → S in BAC27274 (PubMed:16141072).Curated1
Isoform 2 (identifier: Q8BG51-2)
Sequence conflicti593P → T in BAE28113 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019159593P → PEDHYRGSLSRDMGSTDRIE NLRKIWVFLKTAL in isoform 2. 1 Publication1
Alternative sequenceiVSP_019160593P → PHARLRCMCTCNRCTFCICQ NFLNSDLLQSVKNKIFTAVL NR in isoform 3. 2 Publications1
Alternative sequenceiVSP_019161593P → PEDHYRGSLSRDMGSTDRIE NLRKIWVFLKTAFHARLRCM CTCNRCTFCICQNFLNSDLL QSVKNKIFTAVLNR in isoform 4. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019059 mRNA Translation: BAB31529.2
AK028597 mRNA Translation: BAC26025.1
AK031139 mRNA Translation: BAC27274.1 Different initiation.
AK041119 mRNA Translation: BAC30828.1
AK054472 mRNA Translation: BAC35792.1
AK078955 mRNA Translation: BAC37478.1
AK138830 mRNA Translation: BAE23792.1
AK141621 mRNA Translation: BAE24771.1
AK147749 mRNA Translation: BAE28113.1
AK147801 mRNA Translation: BAE28148.1
AK167502 mRNA Translation: BAE39578.1
AL591426 Genomic DNA Translation: CAI25293.1
AL591426 Genomic DNA Translation: CAI25294.1
AL591426 Genomic DNA Translation: CAI25295.1
AL591426 Genomic DNA Translation: CAI25296.1 Sequence problems.
BC006918 mRNA Translation: AAH06918.1
BC046785 mRNA Translation: AAH46785.1
BC058350 mRNA Translation: AAH58350.1
AF244542 mRNA Translation: AAF64187.1 Different initiation.
CCDSiCCDS25130.1 [Q8BG51-1]
CCDS48861.1 [Q8BG51-2]
CCDS48862.1 [Q8BG51-3]
RefSeqiNP_001156826.1, NM_001163354.1 [Q8BG51-2]
NP_001156827.1, NM_001163355.1 [Q8BG51-3]
NP_067511.4, NM_021536.7 [Q8BG51-1]
XP_011247470.1, XM_011249168.2 [Q8BG51-4]
UniGeneiMm.489674

Genome annotation databases

EnsembliENSMUST00000017831; ENSMUSP00000017831; ENSMUSG00000017686 [Q8BG51-2]
ENSMUST00000055056; ENSMUSP00000057669; ENSMUSG00000017686 [Q8BG51-3]
ENSMUST00000077451; ENSMUSP00000076664; ENSMUSG00000017686 [Q8BG51-4]
ENSMUST00000092857; ENSMUSP00000090533; ENSMUSG00000017686 [Q8BG51-1]
GeneIDi59040
KEGGimmu:59040
UCSCiuc007klo.2 mouse [Q8BG51-1]
uc007klp.2 mouse [Q8BG51-2]
uc007klq.2 mouse [Q8BG51-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMIRO1_MOUSE
AccessioniPrimary (citable) accession number: Q8BG51
Secondary accession number(s): Q3TJB7
, Q3UGU4, Q5SYC3, Q5SYC6, Q8BLW3, Q8BMH1, Q922N0, Q9D2R1, Q9JKB9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: March 1, 2003
Last modified: June 20, 2018
This is version 146 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health