Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8AYS8

- KCMA1_CHICK

UniProt

Q8AYS8 - KCMA1_CHICK

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Calcium-activated potassium channel subunit alpha-1

Gene

KCNMA1

Organism
Gallus gallus (Chicken)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).1 Publication

Enzyme regulationi

Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi398 – 3981MagnesiumBy similarity
Metal bindingi421 – 4211MagnesiumBy similarity
Metal bindingi423 – 4231MagnesiumBy similarity
Metal bindingi913 – 9131Calcium; via carbonyl oxygenBy similarity
Metal bindingi916 – 9161Calcium; via carbonyl oxygenBy similarity
Metal bindingi919 – 9191CalciumBy similarity
Metal bindingi921 – 9211CalciumBy similarity

GO - Molecular functioni

  1. large conductance calcium-activated potassium channel activity Source: RefGenome
  2. metal ion binding Source: UniProtKB-KW
  3. voltage-gated potassium channel activity Source: RefGenome

GO - Biological processi

  1. potassium ion transmembrane transport Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Magnesium, Metal-binding, Potassium

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-activated potassium channel subunit alpha-1
Alternative name(s):
BK channel
BKCA alpha
Calcium-activated potassium channel, subfamily M subunit alpha-1
K(VCA)alpha
KCa1.1
Maxi K channel
Short name:
MaxiK
Slo-alpha
Slo1
Slowpoke homolog
Short name:
Slo homolog
Short name:
cSlo
Gene namesi
Name:KCNMA1
Synonyms:KCNMA
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus
ProteomesiUP000000539: Unplaced

Subcellular locationi

Membrane By similarity; Multi-pass membrane protein By similarity

GO - Cellular componenti

  1. voltage-gated potassium channel complex Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11371137Calcium-activated potassium channel subunit alpha-1PRO_0000054138Add
BLAST

Proteomic databases

PaxDbiQ8AYS8.
PRIDEiQ8AYS8.

Interactioni

Subunit structurei

Homotetramer; which constitutes the calcium-activated potassium channel.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
P081063EBI-1635766,EBI-1636307
akt1O575132EBI-1635766,EBI-4306384
ANXA5P171533EBI-1635766,EBI-1635947
ATP1B1P082513EBI-1635766,EBI-7206371
CTTN1Q014062EBI-1635766,EBI-2530463
GSK3BF1NPL82EBI-1635766,EBI-4306413
HPCAL1P423243EBI-1635766,EBI-1636399
HSPA5Q905933EBI-1635766,EBI-1635886
HSPD1Q5ZL723EBI-1635766,EBI-1635874
LIN7CQ5F4253EBI-1635766,EBI-1636456
PDK1F1NLP22EBI-1635766,EBI-4306427
PHBP841733EBI-1635766,EBI-1636878
RAP1AF1NSA82EBI-1635766,EBI-4306330
SNAP25P608783EBI-1635766,EBI-1637031
SOD1P805663EBI-1635766,EBI-1637015
STMN1P313953EBI-1635766,EBI-1636998
VCPQ5ZMU93EBI-1635766,EBI-1637127
YWHAGQ5F3W63EBI-1635766,EBI-1635853

Protein-protein interaction databases

BioGridi675104. 110 interactions.
IntActiQ8AYS8. 107 interactions.
MINTiMINT-7260456.

Structurei

3D structure databases

ProteinModelPortaliQ8AYS8.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4444ExtracellularSequence AnalysisAdd
BLAST
Topological domaini66 – 13772CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini159 – 17315ExtracellularSequence AnalysisAdd
BLAST
Topological domaini195 – 1984CytoplasmicSequence Analysis
Topological domaini220 – 2234ExtracellularSequence Analysis
Topological domaini245 – 25915CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini281 – 29414ExtracellularSequence AnalysisAdd
BLAST
Topological domaini318 – 3269ExtracellularSequence Analysis
Topological domaini348 – 1137790CytoplasmicSequence AnalysisAdd
BLAST

Intramembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei295 – 31723Pore-forming; Name=P regionSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei45 – 6521Helical; Name=Segment S0Sequence AnalysisAdd
BLAST
Transmembranei138 – 15821Helical; Name=Segment S1Sequence AnalysisAdd
BLAST
Transmembranei174 – 19421Helical; Name=Segment S2Sequence AnalysisAdd
BLAST
Transmembranei199 – 21921Helical; Name=Segment S3Sequence AnalysisAdd
BLAST
Transmembranei224 – 24421Helical; Voltage-sensor; Name=Segment S4Sequence AnalysisAdd
BLAST
Transmembranei260 – 28021Helical; Name=Segment S5Sequence AnalysisAdd
BLAST
Transmembranei327 – 34721Helical; Name=Segment S6Sequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini374 – 517144RCK N-terminalAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni515 – 53521Segment S7Add
BLAST
Regioni572 – 59221Segment S8Add
BLAST
Regioni636 – 6405Heme-binding motif
Regioni738 – 75821Segment S9Add
BLAST
Regioni933 – 95321Segment S10Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi311 – 3144Selectivity for potassium
Motifi904 – 92623Calcium bowlAdd
BLAST

Domaini

The S0 segment is essential for the modulation by the accessory beta subunits.By similarity
The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.By similarity
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium (By similarity).By similarity
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ (By similarity).By similarity
The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site. There are however other Ca2+ sensors regions required for activation of the channel (By similarity).By similarity
The heme-binding motif mediates inhibition of channel activation by heme. Carbon monoxide-bound heme leads to increased channel activation (By similarity).By similarity

Sequence similaritiesi

Contains 1 RCK N-terminal domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
HOVERGENiHBG052222.
InParanoidiQ8AYS8.
KOiK04936.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
InterProiIPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003929. K_chnl_Ca-activ_BK_asu.
IPR016040. NAD(P)-bd_dom.
IPR003148. RCK_N.
[Graphical view]
PfamiPF03493. BK_channel_a. 1 hit.
PF00520. Ion_trans. 1 hit.
PF02254. TrkA_N. 1 hit.
[Graphical view]
PRINTSiPR01449. BKCHANNELA.
PR00169. KCHANNEL.

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q8AYS8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSNNINANNL NTDSSSSPVN VPKMDALIIP VTMEVPCDSR GQRMWWAFLA
60 70 80 90 100
SSMVTFFGGL FIILLWRTLK YLWTVCCHCG VKNKEAQKIN GGGDTQADGA
110 120 130 140 150
CKPTDEKEEN VAAEVGWMTS VKDWAGVMIS AQTLTGRVLV VLVFALSIGA
160 170 180 190 200
LVIYFIDSSN PIESCQNFYK DFTLQIDMAF NVFFLLYFGL RFIAANDKLW
210 220 230 240 250
FWLEVNSVVD FFTVPPVFVS VYLNRSWLGL RFLRALRLIQ FSEILQFLNI
260 270 280 290 300
LKTSNSIKLV NLCSIFISTW LTAAGFIHLV ENSGDPWENF QNNQQLTYWE
310 320 330 340 350
CVYLLMVTMS TVGYGDVYAK TTLGRLFMVF FILGGLAMFA SYVPEIIELI
360 370 380 390 400
GNRKKYGGSY SAVSGRKHIV VCGHITLESV SNFLKDFLHK DRDDVNVEIV
410 420 430 440 450
FLHNISPNLE LEALFKRHFT QVEFYQGSVL NPHDLARVKI ESADACLILA
460 470 480 490 500
NKYCADPDAE DASNIMRVIS IKNYHPKIRI ITQMLQYHNK AHLLNIPSWN
510 520 530 540 550
WKEGDDAICL AELKLGFIAQ SCLAPGLSTM LANLFSMRSF IKIEEDTWQK
560 570 580 590 600
YYLEGVANEM YTEYLSSAFV GLSFPAVCEL VFAKLKLLMI AIEYKSEKRE
610 620 630 640 650
SSILINPGNH VKIQEGTLGF FIASDAKEVK RAFFYCKACH DDITDPKRIK
660 670 680 690 700
KCGCKRLEDE QPSTLSPKKK QRNGGMRNSP NSSPKLMRHD PLLIPGNEQI
710 720 730 740 750
DNMDANVKKY DSTGMFHWCP AKDIEKVILT RSEAAMTVLS GHVVVCIFGD
760 770 780 790 800
VKSALIGLRN LVMPLRASNF HYHELKHIVF VGSLEYLRRE WETLHNFPKV
810 820 830 840 850
SILPGTPLSR ADLRAVNINL CDMCVILSAN QNNIDDASLQ DKECILASLN
860 870 880 890 900
IKSMQFDDSI GVLQANSQGF TPPGMDRSSP DNSPVHGLLR QPSITTGANI
910 920 930 940 950
PIITELVNDS NVQFLDQDDD DDPDTELYLT QPFACGTAFA VSVLDSLMSA
960 970 980 990 1000
TYFNDNILTL IRTLVTGGAT PELEALIAEE NALRGGYSTP QTLANRDRCR
1010 1020 1030 1040 1050
VAQLALYDGP FADLGDGGCY GDLFCKALKT YNMLCFGIYR LRDAHLSTPS
1060 1070 1080 1090 1100
QCTKRYVITN PPYEFELVPT DLIFCLMQFD HNAGQSRASL SHSSHSSYSS
1110 1120 1130
SKKSSSVHSI PSTANRPNRT KTRDSREKQK YVQEDRL
Length:1,137
Mass (Da):127,647
Last modified:April 13, 2004 - v2
Checksum:i40A9735E586F0BD1
GO
Isoform 2 (identifier: Q8AYS8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     602-602: S → RSRKR

Show »
Length:1,141
Mass (Da):128,243
Checksum:i60A2C0EAB0534269
GO
Isoform 3 (identifier: Q8AYS8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     657-657: L → PKMSIYKRMKLACCFDCGRSERDCSCMSGSVHSNMDTLERAFPLSSVSVNDCSTSLRAF

Show »
Length:1,195
Mass (Da):134,076
Checksum:i6AAD8F835A7A8177
GO
Isoform 4 (identifier: Q8AYS8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1130-1137: KYVQEDRL → NSTRMNRMGQEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC

Show »
Length:1,189
Mass (Da):133,667
Checksum:iB334AAB3F4714EED
GO
Isoform 5 (identifier: Q8AYS8-5) [UniParc]FASTAAdd to Basket

Also known as: IK

The sequence of this isoform differs from the canonical sequence as follows:
     906-906: L → LAKPGKLLPLVSISQEKNSGTQILMITEL

Show »
Length:1,165
Mass (Da):130,638
Checksum:i905BB9D1B2344E58
GO
Isoform 6 (identifier: Q8AYS8-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     657-657: L → IYF

Show »
Length:1,139
Mass (Da):127,957
Checksum:i45822D895211C704
GO
Isoform 7 (identifier: Q8AYS8-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MSNNINANNLNTDSSSS → MKPFEVSLPPPPPS

Show »
Length:1,134
Mass (Da):127,387
Checksum:i40B414AEFE0F1B55
GO
Isoform 8 (identifier: Q8AYS8-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     160-160: N → KSRTADSLI

Show »
Length:1,145
Mass (Da):128,505
Checksum:iC27FD559A611453C
GO
Isoform 9 (identifier: Q8AYS8-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     602-602: S → RSRKRYALFVTFPSNLNPTST

Show »
Length:1,157
Mass (Da):129,997
Checksum:i6284CAE9979B4A00
GO
Isoform 10 (identifier: Q8AYS8-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-687: M → MRFSCPFLP

Show »
Length:1,145
Mass (Da):128,595
Checksum:i61A433CB6C95073E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti96 – 961Q → R in AAC60378. (PubMed:9178544)Curated
Sequence conflicti397 – 3971V → I in AAC60378. (PubMed:9178544)Curated
Sequence conflicti409 – 4091L → P in AAC35370. (PubMed:10362660)Curated
Sequence conflicti522 – 5221C → S in AAC60378. (PubMed:9178544)Curated
Sequence conflicti712 – 7121S → W in BAC20639. (PubMed:8755483)Curated
Sequence conflicti937 – 9371T → P in BAC20639. (PubMed:8755483)Curated
Sequence conflicti941 – 9411V → D in BAC20639. (PubMed:8755483)Curated
Sequence conflicti1034 – 10341L → F in AAC35370. (PubMed:10362660)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1717MSNNI…DSSSS → MKPFEVSLPPPPPS in isoform 7. 1 PublicationVSP_009983Add
BLAST
Alternative sequencei160 – 1601N → KSRTADSLI in isoform 8. 1 PublicationVSP_009984
Alternative sequencei602 – 6021S → RSRKR in isoform 2. 1 PublicationVSP_009985
Alternative sequencei602 – 6021S → RSRKRYALFVTFPSNLNPTS T in isoform 9. 1 PublicationVSP_009986
Alternative sequencei657 – 6571L → PKMSIYKRMKLACCFDCGRS ERDCSCMSGSVHSNMDTLER AFPLSSVSVNDCSTSLRAF in isoform 3. 2 PublicationsVSP_009987
Alternative sequencei657 – 6571L → IYF in isoform 6. 1 PublicationVSP_009988
Alternative sequencei687 – 6871M → MRFSCPFLP in isoform 10. 1 PublicationVSP_009989
Alternative sequencei906 – 9061L → LAKPGKLLPLVSISQEKNSG TQILMITEL in isoform 5. 2 PublicationsVSP_009990
Alternative sequencei1130 – 11378KYVQEDRL → NSTRMNRMGQEKKWFTDEPD NAYPRNIQIKPMSTHMANQI NQYKSTSSLIPPIREVEDEC in isoform 4. 1 PublicationVSP_009991

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U23821 mRNA. Translation: AAC60378.1.
U23823 mRNA. Translation: AAC60125.1.
U73189 mRNA. Translation: AAB17873.1.
AF087663 mRNA. Translation: AAC35370.1.
AB072618 mRNA. Translation: BAC20639.1.
RefSeqiNP_989555.1. NM_204224.1.
UniGeneiGga.3260.

Genome annotation databases

GeneIDi374065.
KEGGigga:374065.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U23821 mRNA. Translation: AAC60378.1 .
U23823 mRNA. Translation: AAC60125.1 .
U73189 mRNA. Translation: AAB17873.1 .
AF087663 mRNA. Translation: AAC35370.1 .
AB072618 mRNA. Translation: BAC20639.1 .
RefSeqi NP_989555.1. NM_204224.1.
UniGenei Gga.3260.

3D structure databases

ProteinModelPortali Q8AYS8.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 675104. 110 interactions.
IntActi Q8AYS8. 107 interactions.
MINTi MINT-7260456.

Proteomic databases

PaxDbi Q8AYS8.
PRIDEi Q8AYS8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 374065.
KEGGi gga:374065.

Organism-specific databases

CTDi 3778.

Phylogenomic databases

eggNOGi COG1226.
HOVERGENi HBG052222.
InParanoidi Q8AYS8.
KOi K04936.

Miscellaneous databases

NextBioi 20813586.
PROi Q8AYS8.

Family and domain databases

Gene3Di 3.40.50.720. 1 hit.
InterProi IPR005821. Ion_trans_dom.
IPR003091. K_chnl.
IPR003929. K_chnl_Ca-activ_BK_asu.
IPR016040. NAD(P)-bd_dom.
IPR003148. RCK_N.
[Graphical view ]
Pfami PF03493. BK_channel_a. 1 hit.
PF00520. Ion_trans. 1 hit.
PF02254. TrkA_N. 1 hit.
[Graphical view ]
PRINTSi PR01449. BKCHANNELA.
PR00169. KCHANNEL.
ProtoNeti Search...

Publicationsi

  1. "CSlo encodes calcium-activated potassium channels in the chick's cochlea."
    Jiang G.J., Zidanic M., Michaels R.L., Michael T.H., Griguer C., Fuchs P.A.
    Proc. R. Soc. B 264:731-737(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE OF 398-1137 (ISOFORM 4).
    Strain: Leghorn.
    Tissue: Cochlear duct.
  2. "Distribution of Ca2+-activated K+ channel isoforms along the tonotopic gradient of the chicken's cochlea."
    Rosenblatt K.P., Sun Z.-P., Heller S., Hudspeth A.J.
    Neuron 19:1061-1075(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
    Strain: White leghorn.
    Tissue: Brain.
  3. "Molecular biology and electrophysiology of calcium-activated potassium channels from lens epithelium."
    Rae J.L., Shepard A.R.
    Curr. Eye Res. 17:264-275(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: White leghorn.
    Tissue: Lens epithelium.
  4. "Characterization of a newly found stretch-activated KCa,ATP channel in cultured chick ventricular myocytes."
    Kawakubo T., Naruse K., Matsubara T., Hotta N., Sokabe M.
    Am. J. Physiol. 276:H1827-H1838(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 24-1137 (ISOFORM 3).
  5. "Posttranslational regulation of Ca(2+)-activated K+ currents by a target-derived factor in developing parasympathetic neurons."
    Subramony P., Raucher S., Dryer L., Dryer S.E.
    Neuron 17:115-124(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 710-973 (ISOFORM 5).
  6. "A molecular mechanism for electrical tuning of cochlear hair cells."
    Ramanathan K., Michael T.H., Jiang G.-J., Hiel H., Fuchs P.A.
    Science 283:215-217(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiKCMA1_CHICK
AccessioniPrimary (citable) accession number: Q8AYS8
Secondary accession number(s): O12942
, O13110, O93569, Q98951, Q9PS76
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: October 29, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel contains binding sites for Ca2+ and Mg2+.

Caution

It is uncertain whether Met-1 is the initiator or if the sequence starts further upstream.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3