Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mediator of RNA polymerase II transcription subunit 12-like protein

Gene

MED12L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).By similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Mediator of RNA polymerase II transcription subunit 12-like protein
Alternative name(s):
Mediator complex subunit 12-like protein
Thyroid hormone receptor-associated-like protein
Trinucleotide repeat-containing gene 11 protein-like
Gene namesi
Name:MED12L
Synonyms:KIAA1635, TNRC11L, TRALP, TRALPUSH
ORF Names:PRO0314
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:16050. MED12L.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134884590.

Polymorphism and mutation databases

BioMutaiMED12L.
DMDMi166232934.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21452145Mediator of RNA polymerase II transcription subunit 12-like proteinPRO_0000313053Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei462 – 4621PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ86YW9.
MaxQBiQ86YW9.
PaxDbiQ86YW9.
PeptideAtlasiQ86YW9.
PRIDEiQ86YW9.

PTM databases

iPTMnetiQ86YW9.
PhosphoSiteiQ86YW9.

Expressioni

Gene expression databases

BgeeiQ86YW9.
CleanExiHS_MED12L.
ExpressionAtlasiQ86YW9. baseline and differential.
GenevisibleiQ86YW9. HS.

Organism-specific databases

HPAiHPA036807.

Interactioni

Subunit structurei

May be a component of the Mediator complex, which is known to be composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP (By similarity).By similarity

Protein-protein interaction databases

BioGridi125538. 12 interactions.
IntActiQ86YW9. 4 interactions.
MINTiMINT-6778232.
STRINGi9606.ENSP00000417235.

Structurei

3D structure databases

ProteinModelPortaliQ86YW9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1877 – 2134258Gln-richAdd
BLAST

Sequence similaritiesi

Belongs to the Mediator complex subunit 12 family.Curated

Phylogenomic databases

eggNOGiKOG3598. Eukaryota.
ENOG410XP2V. LUCA.
GeneTreeiENSGT00440000037505.
HOGENOMiHOG000231423.
HOVERGENiHBG052447.
InParanoidiQ86YW9.
KOiK15162.
OMAiHYPKDHD.
OrthoDBiEOG7CRTNZ.
PhylomeDBiQ86YW9.
TreeFamiTF324178.

Family and domain databases

InterProiIPR019035. Mediator_Med12.
IPR021989. Mediator_Med12_catenin-bd.
IPR021990. Mediator_Med12_LCEWAV.
[Graphical view]
PfamiPF09497. Med12. 1 hit.
PF12145. Med12-LCEWAV. 1 hit.
PF12144. Med12-PQL. 1 hit.
[Graphical view]
SMARTiSM01281. Med12. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86YW9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAFGLLSYE QRPLKRPRLG PPDVYPQDPK QKEDELTAVN VKQGFNNQPA
60 70 80 90 100
FTGDEHGSAR NIVINPSKIG AYFSSILAEK LKLNTFQDTG KKKPQVNAKD
110 120 130 140 150
NYWLVTARSQ SAIHSWFSDL AGNKPLSILA KKVPILSKKE DVFAYLAKYS
160 170 180 190 200
VPMVRATWLI KMTCAYYSAI SEAKIKKRQA PDPNLEWTQI STRYLREQLA
210 220 230 240 250
KISDFYHMAS STGDGPVPVP PEVEQAMKQW EYNEKLAFHM FQEGMLEKHE
260 270 280 290 300
YLTWILDVLE KIRPMDDDLL KLLLPLMLQY SDEFVQSAYL SRRLAYFCAR
310 320 330 340 350
RLSLLLSDSP NLLAAHSPHM MIGPNNSSIG APSPGPPGPG MSPVQLAFSD
360 370 380 390 400
FLSCAQHGPL VYGLSCMLQT VTLCCPSALV WNYSTNENKS ANPGSPLDLL
410 420 430 440 450
QVAPSSLPMP GGNTAFNQQV RARIYEVEQQ IKQRGRAVEV RWSFDKCQES
460 470 480 490 500
TAGVTISRVL HTLEVLDRHC FDRTDSSNSM ETLYHKIFWA NQNKDNQEVA
510 520 530 540 550
PNDEAVVTLL CEWAVSCKRS GKHRAMAVAK LLEKRQAEIE AERCGESEVL
560 570 580 590 600
DEKESISSSS LAGSSLPVFQ NVLLRFLDTQ APSLSDPNSE CEKVEFVNLV
610 620 630 640 650
LLFCEFIRHD VFSHDAYMCT LISRGDLSVT ASTRPRSPVG ENADEHYSKD
660 670 680 690 700
HDVKMEIFSP MPGESCENAN TSLGRRMSVN CEKLVKREKP RELIFPSNYD
710 720 730 740 750
LLRHLQYATH FPIPLDESSS HECNQRTILL YGVGKERDEA RHQLKKITKD
760 770 780 790 800
ILKILNKKST TETGVGDEGQ KARKNKQETF PTLETVFTKL QLLSYFDQHQ
810 820 830 840 850
VTSQISNNVL EQITSFASGT SYHLPLAHHI QLIFDLMEPA LNINGLIDFA
860 870 880 890 900
IQLLNELSVV EAELLLKSSS LAGSYTTGLC VCIVAVLRRY HSCLILNPDQ
910 920 930 940 950
TAQVFEGLCG VVKHVVNPSE CSSPERCILA YLYDLYVSCS HLRSKFGDLF
960 970 980 990 1000
SSACSKVKQT IYNNVMPANS NLRWDPDFMM DFIENPSARS INYSMLGKIL
1010 1020 1030 1040 1050
SDNAANRYSF VCNTLMNVCM GHQDAGRIND IANFSSELTA CCTVLSSEWL
1060 1070 1080 1090 1100
GVLKALCCSS NHVWGFNDVL CTVDVSDLSF HDSLATFIAI LIARQCFSLE
1110 1120 1130 1140 1150
DVVQHVALPS LLAAACGDAD AEPGARMTCR LLLHLFRAPQ ACFLPQATGK
1160 1170 1180 1190 1200
PFPGIRSSCD RHLLAAAHNS IEVGAVFAVL KAIMMLGDAK IGNNSVSSLK
1210 1220 1230 1240 1250
NDDFTMRGLR CDGNADDIWT ASQNPKSCGK SISIETANLR EYARYVLRTI
1260 1270 1280 1290 1300
CQQEWVGEHC LKEPERLCTD KELILDPVLS NMQAQKLLQL ICYPHGIKEC
1310 1320 1330 1340 1350
TEGDNLQRQH IKRILQNLEQ WTLRQSWLEL QLMIKQCLKD PGSGSVAEMN
1360 1370 1380 1390 1400
NLLDNIAKAT IEVFQQSADL NNSSNSGMSL FNPNSIGSAD TSSTRQNGIK
1410 1420 1430 1440 1450
TFLSSSERRG VWLVAPLIAR LPTSVQGRVL KAAGEELEKG QHLGSSSKKE
1460 1470 1480 1490 1500
RDRQKQKSMS LLSQQPFLSL VLTCLKGQDE QREGLLTSLQ NQVNQILSNW
1510 1520 1530 1540 1550
REERYQDDIK ARQMMHEALQ LRLNLVGGMF DTVQRSTQWT TDWALLLLQI
1560 1570 1580 1590 1600
ITSGTVDMHT NNELFTTVLD MLGVLINGTL ASDLSNASPG GSEENKRAYM
1610 1620 1630 1640 1650
NLVKKLKKEL GDKRSESIDK VRQLLPLPKQ TCDVITCEPM GSLIDTKGNK
1660 1670 1680 1690 1700
IAGFDSIDKK QGLQVSTKQK VSPWDLFEGQ KNPAPLSWAW FGTVRVDRRV
1710 1720 1730 1740 1750
IKYEEQHHLL LYHTHPMPKP RSYYLQPLPL PPEEEEEEPT SPVSQEPERK
1760 1770 1780 1790 1800
SAELSDQGKT TTDEEKKTKG RKRKTKSSSR VDEYPQSNIY RVPPNYSPIS
1810 1820 1830 1840 1850
SQMMHHPQST LWGYNLVGQP QQPGFFLQNQ SLTPGGSRLD PAGSFVPTNT
1860 1870 1880 1890 1900
KQALSNMLQR RSGAMMQPPS LHAITSQQQL IQMKLLQQQQ QQRLLRQAQT
1910 1920 1930 1940 1950
RPFQQGQPGD QAALFAAQAR PSPQLPQYPG LQQAQTMPQG YTMYGTQMPL
1960 1970 1980 1990 2000
QQTSQQQAGS VVLSPSYNSR AYPAAHSNPV LMERLRQIQQ QPSGYVQQQA
2010 2020 2030 2040 2050
SPYLQPLTGS QRLNHQALQQ SPLVGGGIDA VLTSAHPNLP SVPLPQDPMR
2060 2070 2080 2090 2100
PRQPQVRQQQ RLLQMQQPQQ PQPQQPPQPQ QSSQSQSQTL GLQAMQPQQP
2110 2120 2130 2140
LFPRQGLQQT QQQQQTAALV RQLQKQLSSN QPQQGVTPYG HPSHF
Length:2,145
Mass (Da):240,120
Last modified:January 15, 2008 - v2
Checksum:i578F84E1C76004C9
GO
Isoform 2 (identifier: Q86YW9-2) [UniParc]FASTAAdd to basket

Also known as: NOPAR

The sequence of this isoform differs from the canonical sequence as follows:
     716-721: DESSSH → VSHCFS
     722-2145: Missing.

Show »
Length:721
Mass (Da):81,116
Checksum:i145D7B923D068AD5
GO
Isoform 3 (identifier: Q86YW9-3) [UniParc]FASTAAdd to basket

Also known as: NOPAR2

The sequence of this isoform differs from the canonical sequence as follows:
     656-656: E → EEQSIMAHMGIDSGTTNIFDEVDKSDFKTDFGSEFP
     716-721: DESSSH → VSHCFS
     722-2145: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):84,995
Checksum:i3D0F41E8EC5556EF
GO
Isoform 4 (identifier: Q86YW9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     951-951: Missing.

Show »
Length:2,144
Mass (Da):240,032
Checksum:i92D96F83CA8F0A63
GO

Sequence cautioni

The sequence AAF24035.1 differs from that shown.Contaminating sequence. Sequence of unknown origin in the N-terminal part and potential poly-A sequence.Curated
The sequence BAB14198.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1088 – 10881I → T in BAB14198 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti401 – 4011Q → P.
Corresponds to variant rs17290219 [ dbSNP | Ensembl ].
VAR_037647
Natural varianti464 – 4641E → K.
Corresponds to variant rs3108728 [ dbSNP | Ensembl ].
VAR_037648
Natural varianti903 – 9031Q → H.
Corresponds to variant rs2131100 [ dbSNP | Ensembl ].
VAR_037649
Natural varianti1210 – 12101R → Q.
Corresponds to variant rs3732765 [ dbSNP | Ensembl ].
VAR_037650
Natural varianti1698 – 16981R → Q.
Corresponds to variant rs2276761 [ dbSNP | Ensembl ].
VAR_037651

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei656 – 6561E → EEQSIMAHMGIDSGTTNIFD EVDKSDFKTDFGSEFP in isoform 3. 1 PublicationVSP_029994
Alternative sequencei716 – 7216DESSSH → VSHCFS in isoform 2 and isoform 3. 1 PublicationVSP_029995
Alternative sequencei722 – 21451424Missing in isoform 2 and isoform 3. 1 PublicationVSP_029996Add
BLAST
Alternative sequencei951 – 9511Missing in isoform 4. 1 PublicationVSP_029997

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388364 mRNA. Translation: AAL09579.1.
AF388365 mRNA. Translation: AAL09580.1.
AF399708 mRNA. Translation: AAO38813.1.
CH471052 Genomic DNA. Translation: EAW78800.1.
AB046855 mRNA. Translation: BAB13461.1.
AK022714 mRNA. Translation: BAB14198.1. Different initiation.
AF090917 mRNA. Translation: AAF24035.1. Sequence problems.
CCDSiCCDS33876.1. [Q86YW9-1]
RefSeqiNP_443728.3. NM_053002.5. [Q86YW9-1]
XP_011510692.1. XM_011512390.1. [Q86YW9-1]
UniGeneiHs.744234.

Genome annotation databases

EnsembliENST00000309237; ENSP00000310760; ENSG00000144893. [Q86YW9-3]
ENST00000422248; ENSP00000403308; ENSG00000144893. [Q86YW9-2]
ENST00000474524; ENSP00000417235; ENSG00000144893. [Q86YW9-1]
GeneIDi116931.
KEGGihsa:116931.
UCSCiuc003eyn.3. human. [Q86YW9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388364 mRNA. Translation: AAL09579.1.
AF388365 mRNA. Translation: AAL09580.1.
AF399708 mRNA. Translation: AAO38813.1.
CH471052 Genomic DNA. Translation: EAW78800.1.
AB046855 mRNA. Translation: BAB13461.1.
AK022714 mRNA. Translation: BAB14198.1. Different initiation.
AF090917 mRNA. Translation: AAF24035.1. Sequence problems.
CCDSiCCDS33876.1. [Q86YW9-1]
RefSeqiNP_443728.3. NM_053002.5. [Q86YW9-1]
XP_011510692.1. XM_011512390.1. [Q86YW9-1]
UniGeneiHs.744234.

3D structure databases

ProteinModelPortaliQ86YW9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125538. 12 interactions.
IntActiQ86YW9. 4 interactions.
MINTiMINT-6778232.
STRINGi9606.ENSP00000417235.

PTM databases

iPTMnetiQ86YW9.
PhosphoSiteiQ86YW9.

Polymorphism and mutation databases

BioMutaiMED12L.
DMDMi166232934.

Proteomic databases

EPDiQ86YW9.
MaxQBiQ86YW9.
PaxDbiQ86YW9.
PeptideAtlasiQ86YW9.
PRIDEiQ86YW9.

Protocols and materials databases

DNASUi116931.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309237; ENSP00000310760; ENSG00000144893. [Q86YW9-3]
ENST00000422248; ENSP00000403308; ENSG00000144893. [Q86YW9-2]
ENST00000474524; ENSP00000417235; ENSG00000144893. [Q86YW9-1]
GeneIDi116931.
KEGGihsa:116931.
UCSCiuc003eyn.3. human. [Q86YW9-1]

Organism-specific databases

CTDi116931.
GeneCardsiMED12L.
HGNCiHGNC:16050. MED12L.
HPAiHPA036807.
MIMi611318. gene.
neXtProtiNX_Q86YW9.
PharmGKBiPA134884590.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3598. Eukaryota.
ENOG410XP2V. LUCA.
GeneTreeiENSGT00440000037505.
HOGENOMiHOG000231423.
HOVERGENiHBG052447.
InParanoidiQ86YW9.
KOiK15162.
OMAiHYPKDHD.
OrthoDBiEOG7CRTNZ.
PhylomeDBiQ86YW9.
TreeFamiTF324178.

Miscellaneous databases

ChiTaRSiMED12L. human.
GenomeRNAii116931.
PROiQ86YW9.
SOURCEiSearch...

Gene expression databases

BgeeiQ86YW9.
CleanExiHS_MED12L.
ExpressionAtlasiQ86YW9. baseline and differential.
GenevisibleiQ86YW9. HS.

Family and domain databases

InterProiIPR019035. Mediator_Med12.
IPR021989. Mediator_Med12_catenin-bd.
IPR021990. Mediator_Med12_LCEWAV.
[Graphical view]
PfamiPF09497. Med12. 1 hit.
PF12145. Med12-LCEWAV. 1 hit.
PF12144. Med12-PQL. 1 hit.
[Graphical view]
SMARTiSM01281. Med12. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
  2. "Tralpush, a novel transcription-related gene, that spans the entire USHER syndrome type-3 linkage interval encloses five G-protein-coupled receptor genes nested within its introns."
    Adato A., Avidan N., Ben-Asher E., Khen M., Man O., Beckmann J.S., Bonne-Tamir B., Lancet D.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 711-2145 (ISOFORM 1).
    Tissue: Brain.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 808-1763 (ISOFORM 4).
  6. "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs."
    Yu Y., Zhang C., Zhou G., Wu S., Qu X., Wei H., Xing G., Dong C., Zhai Y., Wan J., Ouyang S., Li L., Zhang S., Zhou K., Zhang Y., Wu C., He F.
    Genome Res. 11:1392-1403(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1175-1608 (ISOFORMS 1/4).
    Tissue: Fetal liver.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-462, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiMD12L_HUMAN
AccessioniPrimary (citable) accession number: Q86YW9
Secondary accession number(s): Q96PC7
, Q96PC8, Q9H9M5, Q9HCD7, Q9UI69
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: July 6, 2016
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.