Q86YS7 (C2CD5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C2 domain-containing protein 5 Alternative name(s): C2 domain-containing phosphoprotein of 138 kDa | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1000 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for insulin-stimulated glucose transport and glucose transporter SLC2A4/GLUT4 translocation from intracellular glucose storage vesicle (GSV) to the plasma membrane (PM) in adipocytes. Binds phospholipid membranes in a calcium-dependent manner and is necessary for the optimal membrane fusion between SLC2A4/GLUT4 GSV and the PM. Ref.14 |
| Cofactor | Binds 2 calcium ions per subunit. The ions are bound to the C2 domains. |
| Subcellular location | Cytoplasmic vesicle membrane. Cytoplasm › cell cortex. Cell membrane. Cell projection › ruffle. Note: Dynamically associated with GLUT4-containing glucose storage vesicles (GSV) and plasma membrane in response to insulin stimulation. Ref.14 |
| Domain | The C2 domain binds to calcium and membrane lipids. |
| Post-translational modification | Phosphorylated on Ser-197 by active myristoylated kinase AKT2; insulin-stimulated phosphorylation by AKT2 regulates SLC2A4/GLUT4 translocation into the plasma membrane. Ref.14 |
| Sequence similarities | Contains 1 C2 domain. |
| Sequence caution | The sequence BAA25454.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86YS7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86YS7-2) The sequence of this isoform differs from the canonical sequence as follows: 268-316: IPFNEDPNPN...SDTDLSLTPK → SPLVHPPSHG...FSVSVPTLIY 844-845: KA → KEHLESASSNSGIPAAQRATSVDYSSFADRCSSWIELIKLKAQTIRRGSIKTT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1000 | 1000 | C2 domain-containing protein 5 | PRO_0000247450 | |||||
Regions | |||||||||
| Domain | 1 – 90 | 90 | C2 | ||||||
| Calcium binding | 13 – 27 | 15 | 1; low affinity Ref.14 | ||||||
| Calcium binding | 75 – 86 | 12 | 2; high affinity Ref.14 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 197 | 1 | Phosphoserine; by PKB/AKT2 Ref.14 | ||||||
| Modified residue | 200 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 260 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 262 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 293 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 295 | 1 | Phosphoserine Ref.12 Ref.15 | ||||||
| Modified residue | 317 | 1 | Phosphothreonine Ref.10 | ||||||
| Modified residue | 601 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 643 | 1 | Phosphoserine Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 659 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Modified residue | 852 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 268 – 316 | 49 | IPFNE…SLTPK → SPLVHPPSHGCRSTHNSPIH TATGSRLTQNFSVSVPTLIY in isoform 2. | VSP_028255 | |||||
| Alternative sequence | 844 – 845 | 2 | KA → KEHLESASSNSGIPAAQRAT SVDYSSFADRCSSWIELIKL KAQTIRRGSIKTT in isoform 2. | VSP_028256 | |||||
Experimental info | |||||||||
| Mutagenesis | 19 | 1 | D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-26; A-76; A-78 and A-84. Ref.14 | ||||||
| Mutagenesis | 26 | 1 | D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-76; A-78 and A-84. Ref.14 | ||||||
| Mutagenesis | 76 | 1 | D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-26; A-78 and A-84. Ref.14 | ||||||
| Mutagenesis | 78 | 1 | D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-26; A-76 and A-84. Ref.14 | ||||||
| Mutagenesis | 84 | 1 | D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-26; A-76 and A-78. Ref.14 | ||||||
| Mutagenesis | 197 | 1 | S → A: Inhibits insulin-stimulated AKT2-induced phosphorylation, SLC2A4/GLUT4 translocation to the cell surface and GSV-PM fusion. Ref.14 | ||||||
| Mutagenesis | 200 | 1 | S → A: Does not inhibit insulin-stimulated SLC2A4/GLUT4 translocation. Ref.14 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | Ohara O., Nagase T., Ishikawa K. Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Guo J.H., Yu L. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Cerebellum and Lung carcinoma. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-643, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-601; SER-643 AND SER-852, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-643; SER-659 AND SER-852, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-317; SER-643 AND SER-852, MASS SPECTROMETRY. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-643 AND SER-659, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-295, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "C2 domain-containing phosphoprotein CDP138 regulates GLUT4 insertion into the plasma membrane." Xie X., Gong Z., Mansuy-Aubert V., Zhou Q.L., Tatulian S.A., Sehrt D., Gnad F., Brill L.M., Motamedchaboki K., Chen Y., Czech M.P., Mann M., Kruger M., Jiang Z.Y. Cell Metab. 14:378-389(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT SER-197 AND SER-200, INTERACTION WITH PHOSPHOLIPIDS, CALCIUM-BINDING, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-19; ASP-26; ASP-76; ASP-78; ASP-84; SER-197 AND SER-200, MASS SEPCTROMETRY. |
| [15] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293; SER-295 AND SER-852, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB011100 mRNA. Translation: BAA25454.3. Different initiation. AC053513 Genomic DNA. No translation available. AY166851 mRNA. Translation: AAO17290.1. BC042498 mRNA. Translation: AAH42498.2. BC053885 mRNA. Translation: AAH53885.1. BC117143 mRNA. Translation: AAI17144.1. |
| IPI | IPI00465142. IPI00783895. |
| PIR | T00072. |
| RefSeq | NP_055617.1. NM_014802.1. |
| UniGene | Hs.271014. |
3D structure databases | |
| ProteinModelPortal | Q86YS7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86YS7. 1 interaction. |
| STRING | 9606.ENSP00000334229. |
PTM databases | |
| PhosphoSite | Q86YS7. |
Polymorphism databases | |
| DMDM | 74750574. |
Proteomic databases | |
| PaxDb | Q86YS7. |
| PRIDE | Q86YS7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000333957; ENSP00000334229; ENSG00000111731. ENST00000396028; ENSP00000379345; ENSG00000111731. |
| GeneID | 9847. |
| KEGG | hsa:9847. |
| UCSC | uc001rfq.3. human. uc001rfr.3. human. |
Organism-specific databases | |
| CTD | 9847. |
| GeneCards | GC12M022601. |
| HGNC | HGNC:29062. C2CD5. |
| HPA | HPA046194. |
| neXtProt | NX_Q86YS7. |
| PharmGKB | PA143485515. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG235531. |
| HOGENOM | HOG000006746. |
| HOVERGEN | HBG081824. |
| OrthoDB | EOG4C2H8T. |
Gene expression databases | |
| ArrayExpress | Q86YS7. |
| Bgee | Q86YS7. |
| CleanEx | HS_KIAA0528. |
| Genevestigator | Q86YS7. |
| GermOnline | ENSG00000111731. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. [Graphical view] |
| Pfam | PF00168. C2. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 9847. |
| NextBio | 37112. |
Entry information
| Entry name | C2CD5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86YS7 Secondary accession number(s): O60280 Q86SU3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
