Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86YN6

- PRGC2_HUMAN

UniProt

Q86YN6 - PRGC2_HUMAN

Protein

Peroxisome proliferator-activated receptor gamma coactivator 1-beta

Gene

PPARGC1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcritional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner.4 Publications

    GO - Molecular functioni

    1. AF-2 domain binding Source: UniProtKB
    2. estrogen receptor binding Source: UniProtKB
    3. ligand-dependent nuclear receptor transcription coactivator activity Source: UniProtKB
    4. nucleotide binding Source: InterPro
    5. receptor activator activity Source: UniProtKB
    6. RNA binding Source: UniProtKB
    7. RNA polymerase II transcription cofactor activity Source: UniProtKB

    GO - Biological processi

    1. actin filament organization Source: Ensembl
    2. bone trabecula formation Source: Ensembl
    3. cellular lipid metabolic process Source: Reactome
    4. cellular response to reactive oxygen species Source: Ensembl
    5. intracellular estrogen receptor signaling pathway Source: UniProtKB
    6. negative regulation of transcription, DNA-templated Source: Ensembl
    7. ossification Source: Ensembl
    8. positive regulation of alkaline phosphatase activity Source: Ensembl
    9. positive regulation of bone resorption Source: Ensembl
    10. positive regulation of osteoclast differentiation Source: Ensembl
    11. positive regulation of phosphorylation Source: Ensembl
    12. positive regulation of receptor activity Source: GOC
    13. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    14. regulation of transcription, DNA-templated Source: UniProtKB
    15. response to cAMP Source: Ensembl
    16. response to glucocorticoid Source: Ensembl
    17. small molecule metabolic process Source: Reactome
    18. transcription from mitochondrial promoter Source: Ensembl
    19. transcription from RNA polymerase II promoter Source: GOC

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    RNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_116145. PPARA activates gene expression.
    REACT_200608. Transcriptional activation of mitochondrial biogenesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Peroxisome proliferator-activated receptor gamma coactivator 1-beta
    Short name:
    PGC-1-beta
    Short name:
    PPAR-gamma coactivator 1-beta
    Short name:
    PPARGC-1-beta
    Alternative name(s):
    PGC-1-related estrogen receptor alpha coactivator
    Gene namesi
    Name:PPARGC1B
    Synonyms:PERC, PGC1, PGC1B, PPARGC1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:30022. PPARGC1B.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. mediator complex Source: UniProtKB
    2. mitochondrion Source: GOC
    3. nucleoplasm Source: Reactome
    4. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi92 – 965LLAEL → AAAEA: Reduces DNA transcriptional activity. 1 Publication
    Mutagenesisi155 – 1606LLQKLL → AAQKAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 343-AREAA-347. 1 Publication
    Mutagenesisi343 – 3475LRELL → AREAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 155-AAQKAA-160. 1 Publication

    Organism-specific databases

    PharmGKBiPA134953410.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10231023Peroxisome proliferator-activated receptor gamma coactivator 1-betaPRO_0000240158Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei524 – 5241Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ86YN6.
    PRIDEiQ86YN6.

    PTM databases

    PhosphoSiteiQ86YN6.

    Expressioni

    Tissue specificityi

    Ubiquitous with higher expression in heart, brain and skeletal muscle.2 Publications

    Inductioni

    Repressed by saturated fatty acids such as palmitate and stearate in skeletal muscle cells. Induced by insulin and reduced by aging in skeletal muscle biopsies. Down-regulated in type 2 diabetes mellitus subjects as well as in pre-diabetics.2 Publications

    Gene expression databases

    BgeeiQ86YN6.
    CleanExiHS_PPARGC1B.
    GenevestigatoriQ86YN6.

    Interactioni

    Subunit structurei

    Interacts with hepatocyte nuclear factor 4-alpha/HNF4A, Sterol regulatory binding transcription factor 1/SREBF1, PPAR-alpha/PPARA, thyroid hormone receptor beta/THRB and host cell factor/HCFC1. Interacts with estrogen-related receptor gamma/ESRRG and alpha/ESRRA. Interacts with PRDM16 By similarity. Interacts with estrogen receptor alpha/ESR1.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi126361. 17 interactions.

    Structurei

    Secondary structure

    1
    1023
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi155 – 1628

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3SP6X-ray2.21B153-163[»]
    ProteinModelPortaliQ86YN6.
    SMRiQ86YN6. Positions 903-964.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ86YN6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini902 – 97675RRMPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 9191Abolishes DNA transcriptional activity when missingAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi156 – 1605LXXLL motif 1
    Motifi343 – 3475LXXLL motif 2
    Motifi691 – 6944HCFC1-binding-motif (HBM)

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi430 – 45021Glu-richAdd
    BLAST
    Compositional biasi772 – 82352Glu-richAdd
    BLAST

    Domaini

    Sequence similaritiesi

    Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG87590.
    HOGENOMiHOG000236356.
    HOVERGENiHBG080730.
    InParanoidiQ86YN6.
    KOiK17962.
    OMAiCESGCGD.
    OrthoDBiEOG7S4X5H.
    PhylomeDBiQ86YN6.
    TreeFamiTF343068.

    Family and domain databases

    Gene3Di3.30.70.330. 1 hit.
    InterProiIPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view]
    PfamiPF00076. RRM_1. 1 hit.
    [Graphical view]
    SMARTiSM00360. RRM. 1 hit.
    [Graphical view]
    PROSITEiPS50102. RRM. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86YN6-1) [UniParc]FASTAAdd to Basket

    Also known as: PGC1beta-1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGNDCGALL DEELSSFFLN YLADTQGGGS GEEQLYADFP ELDLSQLDAS     50
    DFDSATCFGE LQWCPENSET EPNQYSPDDS ELFQIDSENE ALLAELTKTL 100
    DDIPEDDVGL AAFPALDGGD ALSCTSASPA PSSAPPSPAP EKPSAPAPEV 150
    DELSLLQKLL LATSYPTSSS DTQKEGTAWR QAGLRSKSQR PCVKADSTQD 200
    KKAPMMQSQS RSCTELHKHL TSAQCCLQDR GLQPPCLQSP RLPAKEDKEP 250
    GEDCPSPQPA PASPRDSLAL GRADPGAPVS QEDMQAMVQL IRYMHTYCLP 300
    QRKLPPQTPE PLPKACSNPS QQVRSRPWSR HHSKASWAEF SILRELLAQD 350
    VLCDVSKPYR LATPVYASLT PRSRPRPPKD SQASPGRPSS VEEVRIAASP 400
    KSTGPRPSLR PLRLEVKREV RRPARLQQQE EEDEEEEEEE EEEEKEEEEE 450
    WGRKRPGRGL PWTKLGRKLE SSVCPVRRSR RLNPELGPWL TFADEPLVPS 500
    EPQGALPSLC LAPKAYDVER ELGSPTDEDS GQDQQLLRGP QIPALESPCE 550
    SGCGDMDEDP SCPQLPPRDS PRCLMLALSQ SDPTFGKKSF EQTLTVELCG 600
    TAGLTPPTTP PYKPTEEDPF KPDIKHSLGK EIALSLPSPE GLSLKATPGA 650
    AHKLPKKHPE RSELLSHLRH ATAQPASQAG QKRPFSCSFG DHDYCQVLRP 700
    EGVLQRKVLR SWEPSGVHLE DWPQQGAPWA EAQAPGREED RSCDAGAPPK 750
    DSTLLRDHEI RASLTKHFGL LETALEEEDL ASCKSPEYDT VFEDSSSSSG 800
    ESSFLPEEEE EEGEEEEEDD EEEDSGVSPT CSDHCPYQSP PSKANRQLCS 850
    RSRSSSGSSP CHSWSPATRR NFRCESRGPC SDRTPSIRHA RKRREKAIGE 900
    GRVVYIQNLS SDMSSRELKR RFEVFGEIEE CEVLTRNRRG EKYGFITYRC 950
    SEHAALSLTK GAALRKRNEP SFQLSYGGLR HFCWPRYTDY DSNSEEALPA 1000
    SGKSKYEAMD FDSLLKEAQQ SLH 1023
    Length:1,023
    Mass (Da):113,222
    Last modified:October 17, 2006 - v2
    Checksum:iDC37FCDE4D3CD239
    GO
    Isoform 2 (identifier: Q86YN6-2) [UniParc]FASTAAdd to Basket

    Also known as: PGC1beta-2a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK

    Show »
    Length:1,002
    Mass (Da):110,981
    Checksum:i8ACBD368E172B27E
    GO
    Isoform 3 (identifier: Q86YN6-3) [UniParc]FASTAAdd to Basket

    Also known as: PGC1beta-1b

    The sequence of this isoform differs from the canonical sequence as follows:
         991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS

    Show »
    Length:1,017
    Mass (Da):112,568
    Checksum:iF2229A0A356A2148
    GO
    Isoform 4 (identifier: Q86YN6-4) [UniParc]FASTAAdd to Basket

    Also known as: PGC1beta-2b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK
         991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS

    Show »
    Length:996
    Mass (Da):110,327
    Checksum:i5265F3916B919ECC
    GO
    Isoform 5 (identifier: Q86YN6-5) [UniParc]FASTAAdd to Basket

    Also known as: PERC-s

    The sequence of this isoform differs from the canonical sequence as follows:
         156-194: Missing.

    Note: Lacks LXXLL motif 1 and has a reduced ability to enhance the hormone-dependent activity of estrogen receptor alpha.

    Show »
    Length:984
    Mass (Da):108,919
    Checksum:i5D91928FD6D6D104
    GO
    Isoform 6 (identifier: Q86YN6-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-26: MAGNDCGALLDEELSSFFLNYLADTQ → M
         156-194: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:959
    Mass (Da):106,230
    Checksum:iD4E5EF57FC0C2459
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti558 – 5581E → G in BAC04541. (PubMed:14702039)Curated

    Polymorphismi

    Variation of PPARGC1B may contribute to the pathogenesis of obesity, with a widespread Ala-203 allele being a risk factor for the development of this common disorders.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti203 – 2031A → P.1 Publication
    Corresponds to variant rs7732671 [ dbSNP | Ensembl ].
    VAR_026698
    Natural varianti265 – 2651R → Q.1 Publication
    Corresponds to variant rs45520937 [ dbSNP | Ensembl ].
    VAR_026699
    Natural varianti279 – 2791V → I.1 Publication
    Corresponds to variant rs17572019 [ dbSNP | Ensembl ].
    VAR_026700
    Natural varianti292 – 2921R → S.2 Publications
    Corresponds to variant rs11959820 [ dbSNP | Ensembl ].
    VAR_026701

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2626MAGND…LADTQ → MGVYK in isoform 2 and isoform 4. 1 PublicationVSP_019299Add
    BLAST
    Alternative sequencei1 – 2626MAGND…LADTQ → M in isoform 6. 1 PublicationVSP_043374Add
    BLAST
    Alternative sequencei156 – 19439Missing in isoform 5 and isoform 6. 2 PublicationsVSP_019300Add
    BLAST
    Alternative sequencei991 – 102333DSNSE…QQSLH → GKPLKPSHSLVRLKAWEAVP SLNKTQS in isoform 3 and isoform 4. 1 PublicationVSP_019301Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF468496 mRNA. Translation: AAL78633.1.
    AF468497 mRNA. Translation: AAL78634.1.
    AY188947 mRNA. Translation: AAO40022.1.
    AY188948 mRNA. Translation: AAO40023.1.
    AY188949 mRNA. Translation: AAO40024.1.
    AY188950 mRNA. Translation: AAO40025.1.
    AK095391 mRNA. Translation: BAC04541.1.
    AK123614 mRNA. Translation: BAG53922.1.
    AC008545 Genomic DNA. No translation available.
    AC022100 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61759.1.
    BC132971 mRNA. Translation: AAI32972.1.
    BC132973 mRNA. Translation: AAI32974.1.
    CCDSiCCDS4298.1. [Q86YN6-1]
    CCDS54933.1. [Q86YN6-5]
    CCDS54934.1. [Q86YN6-6]
    RefSeqiNP_001166169.1. NM_001172698.1. [Q86YN6-5]
    NP_001166170.1. NM_001172699.1. [Q86YN6-6]
    NP_573570.3. NM_133263.3. [Q86YN6-1]
    XP_005268429.1. XM_005268372.2. [Q86YN6-2]
    UniGeneiHs.483816.

    Genome annotation databases

    EnsembliENST00000309241; ENSP00000312649; ENSG00000155846. [Q86YN6-1]
    ENST00000360453; ENSP00000353638; ENSG00000155846. [Q86YN6-5]
    ENST00000394320; ENSP00000377855; ENSG00000155846. [Q86YN6-3]
    ENST00000403750; ENSP00000384403; ENSG00000155846. [Q86YN6-6]
    GeneIDi133522.
    KEGGihsa:133522.
    UCSCiuc003lrb.2. human. [Q86YN6-3]
    uc003lrc.3. human. [Q86YN6-1]
    uc003lrd.3. human. [Q86YN6-5]
    uc003lre.1. human. [Q86YN6-4]
    uc003lrf.3. human. [Q86YN6-2]
    uc021yfr.1. human. [Q86YN6-6]

    Polymorphism databases

    DMDMi116242724.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF468496 mRNA. Translation: AAL78633.1 .
    AF468497 mRNA. Translation: AAL78634.1 .
    AY188947 mRNA. Translation: AAO40022.1 .
    AY188948 mRNA. Translation: AAO40023.1 .
    AY188949 mRNA. Translation: AAO40024.1 .
    AY188950 mRNA. Translation: AAO40025.1 .
    AK095391 mRNA. Translation: BAC04541.1 .
    AK123614 mRNA. Translation: BAG53922.1 .
    AC008545 Genomic DNA. No translation available.
    AC022100 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61759.1 .
    BC132971 mRNA. Translation: AAI32972.1 .
    BC132973 mRNA. Translation: AAI32974.1 .
    CCDSi CCDS4298.1. [Q86YN6-1 ]
    CCDS54933.1. [Q86YN6-5 ]
    CCDS54934.1. [Q86YN6-6 ]
    RefSeqi NP_001166169.1. NM_001172698.1. [Q86YN6-5 ]
    NP_001166170.1. NM_001172699.1. [Q86YN6-6 ]
    NP_573570.3. NM_133263.3. [Q86YN6-1 ]
    XP_005268429.1. XM_005268372.2. [Q86YN6-2 ]
    UniGenei Hs.483816.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3SP6 X-ray 2.21 B 153-163 [» ]
    ProteinModelPortali Q86YN6.
    SMRi Q86YN6. Positions 903-964.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126361. 17 interactions.

    PTM databases

    PhosphoSitei Q86YN6.

    Polymorphism databases

    DMDMi 116242724.

    Proteomic databases

    PaxDbi Q86YN6.
    PRIDEi Q86YN6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000309241 ; ENSP00000312649 ; ENSG00000155846 . [Q86YN6-1 ]
    ENST00000360453 ; ENSP00000353638 ; ENSG00000155846 . [Q86YN6-5 ]
    ENST00000394320 ; ENSP00000377855 ; ENSG00000155846 . [Q86YN6-3 ]
    ENST00000403750 ; ENSP00000384403 ; ENSG00000155846 . [Q86YN6-6 ]
    GeneIDi 133522.
    KEGGi hsa:133522.
    UCSCi uc003lrb.2. human. [Q86YN6-3 ]
    uc003lrc.3. human. [Q86YN6-1 ]
    uc003lrd.3. human. [Q86YN6-5 ]
    uc003lre.1. human. [Q86YN6-4 ]
    uc003lrf.3. human. [Q86YN6-2 ]
    uc021yfr.1. human. [Q86YN6-6 ]

    Organism-specific databases

    CTDi 133522.
    GeneCardsi GC05P149109.
    HGNCi HGNC:30022. PPARGC1B.
    MIMi 608886. gene.
    neXtProti NX_Q86YN6.
    PharmGKBi PA134953410.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG87590.
    HOGENOMi HOG000236356.
    HOVERGENi HBG080730.
    InParanoidi Q86YN6.
    KOi K17962.
    OMAi CESGCGD.
    OrthoDBi EOG7S4X5H.
    PhylomeDBi Q86YN6.
    TreeFami TF343068.

    Enzyme and pathway databases

    Reactomei REACT_116145. PPARA activates gene expression.
    REACT_200608. Transcriptional activation of mitochondrial biogenesis.

    Miscellaneous databases

    EvolutionaryTracei Q86YN6.
    GeneWikii PPARGC1B.
    GenomeRNAii 133522.
    NextBioi 83227.
    PROi Q86YN6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q86YN6.
    CleanExi HS_PPARGC1B.
    Genevestigatori Q86YN6.

    Family and domain databases

    Gene3Di 3.30.70.330. 1 hit.
    InterProi IPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view ]
    Pfami PF00076. RRM_1. 1 hit.
    [Graphical view ]
    SMARTi SM00360. RRM. 1 hit.
    [Graphical view ]
    PROSITEi PS50102. RRM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha."
      Kressler D., Schreiber S.N., Knutti D., Kralli A.
      J. Biol. Chem. 277:13918-13925(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), SUBCELLULAR LOCATION, MOTIF, TISSUE SPECIFICITY, MUTAGENESIS OF 92-LEU--LEU-96; 155-LEU--LEU-160 AND 343-LEU--LEU-347, INTERACTION WITH ESR1, FUNCTION.
    2. "Characterization of the human, mouse and rat PGC1 beta (peroxisome-proliferator-activated receptor-gamma co-activator 1 beta) gene in vitro and in vivo."
      Meirhaeghe A., Crowley V., Lenaghan C., Lelliott C., Green K., Stewart A., Hart K., Schinner S., Sethi J.K., Yeo G., Brand M.D., Cortright R.N., O'Rahilly S., Montague C., Vidal-Puig A.J.
      Biochem. J. 373:155-165(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, FUNCTION, VARIANT GLN-265.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6).
      Tissue: Tongue.
    4. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-292.
    7. "Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: potential role of PGC1 and NRF1."
      Patti M.E., Butte A.J., Crunkhorn S., Cusi K., Berria R., Kashyap S., Miyazaki Y., Kohane I., Costello M., Saccone R., Landaker E.J., Goldfine A.B., Mun E., DeFronzo R., Finlayson J., Kahn C.R., Mandarino L.J.
      Proc. Natl. Acad. Sci. U.S.A. 100:8466-8471(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    8. "Multiple environmental and genetic factors influence skeletal muscle PGC-1alpha and PGC-1beta gene expression in twins."
      Ling C., Poulsen P., Carlsson E., Ridderstrale M., Almgren P., Wojtaszewski J., Beck-Nielsen H., Groop L., Vaag A.
      J. Clin. Invest. 114:1518-1526(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INDUCTION BY INSULIN AND AGING.
    9. "Evidence of an association between genetic variation of the coactivator PGC-1beta and obesity."
      Andersen G., Wegner L., Yanagisawa K., Rose C.S., Lin J., Gluemer C., Drivsholm T., Borch-Johnsen K., Jorgensen T., Hansen T., Spiegelman B.M., Pedersen O.
      J. Med. Genet. 42:402-407(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: POLYMORPHISM, VARIANTS PRO-203; ILE-279 AND SER-292.
    10. "Fatty acid-induced differential regulation of the genes encoding peroxisome proliferator-activated receptor-gamma coactivator-1alpha and -1beta in human skeletal muscle cells that have been differentiated in vitro."
      Staiger H., Staiger K., Haas C., Weisser M., Machicao F., Haering H.-U.
      Diabetologia 48:2115-2118(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: REGULATION BY FATTY ACIDS.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-524, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells."
      Cho Y., Hazen B.C., Russell A.P., Kralli A.
      J. Biol. Chem. 288:25207-25218(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiPRGC2_HUMAN
    AccessioniPrimary (citable) accession number: Q86YN6
    Secondary accession number(s): A2RUM8
    , A2RUN0, B3KVW0, Q86YN3, Q86YN4, Q86YN5, Q8N1N9, Q8TDE4, Q8TDE5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 13, 2006
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 104 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3