Reviewed,
UniProtKB/Swiss-Prot Q86YN6 (PRGC2_HUMAN)
Last modified
January 19, 2010.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Peroxisome proliferator-activated receptor gamma coactivator 1-beta Short name=PPAR-gamma coactivator 1-beta Short name=PPARGC-1-beta Short name=PGC-1-beta Alternative name(s): PGC-1-related estrogen receptor alpha coactivator | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1023 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcritional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Ref.1 Ref.2 Ref.7 |
| Subunit structure | Interacts with hepatocyte nuclear factor 4-alpha/HNF4A, Sterol regulatory binding transcription factor 1/SREBF1, PPAR-alpha/PPARA, thyroid hormone receptor beta/THRB and host cell factor/HCFC1. Interacts with estrogen-related receptor gamma/ESRRG and alpha/ESRRA. Interacts with PRDM16 By similarity. Interacts with estrogen receptor alpha/ESR1. Ref.1 |
| Subcellular location | |
| Tissue specificity | Ubiquitous with higher expression in heart, brain and skeletal muscle. Ref.1 Ref.2 |
| Induction | Repressed by saturated fatty acids such as palmitate and stearate in skeletal muscle cells. Induced by insulin and reduced by aging in skeletal muscle biopsies. Down-regulated in type 2 diabetes mellitus subjects as well as in pre-diabetics. Ref.7 Ref.6 Ref.9 |
| Domain | Contains 2 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motif, which are usually required for the association with nuclear receptors By similarity. |
| Polymorphism | Variation of PPARGC1B may contribute to the pathogenesis of obesity, with a widespread Ala-203 allele being a risk factor for the development of this common disorders. |
| Sequence similarities | Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86YN6-1) Also known as: PGC1beta-1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86YN6-2) Also known as: PGC1beta-2a; The sequence of this isoform differs from the canonical sequence as follows: 1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK | ||||||
| Isoform 3 (identifier: Q86YN6-3) Also known as: PGC1beta-1b; The sequence of this isoform differs from the canonical sequence as follows: 991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS | ||||||
| Isoform 4 (identifier: Q86YN6-4) Also known as: PGC1beta-2b; The sequence of this isoform differs from the canonical sequence as follows: 1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK 991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS | ||||||
| Isoform 5 (identifier: Q86YN6-5) Also known as: PERC-s; The sequence of this isoform differs from the canonical sequence as follows: 156-194: Missing. | ||||||
| Note: Lacks LXXLL motif 1 and has a reduced ability to enhance the hormone-dependent activity of estrogen receptor alpha. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1023 | 1023 | Peroxisome proliferator-activated receptor gamma coactivator 1-beta | PRO_0000240158 | |||||
Regions | |||||||||
| Domain | 902 – 976 | 75 | RRM | ||||||
| Region | 1 – 91 | 91 | Abolishes DNA transcriptional activity when missing | ||||||
| Motif | 156 – 160 | 5 | LXXLL motif 1 | ||||||
| Motif | 343 – 347 | 5 | LXXLL motif 2 | ||||||
| Motif | 691 – 694 | 4 | HCFC1-binding-motif (HBM) | ||||||
| Compositional bias | 430 – 450 | 21 | Glu-rich | ||||||
| Compositional bias | 772 – 823 | 52 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 524 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 26 | 26 | MAGND…LADTQ → MGVYK in isoform 2 and isoform 4. | VSP_019299 | |||||
| Alternative sequence | 156 – 194 | 39 | Missing in isoform 5. | VSP_019300 | |||||
| Alternative sequence | 991 – 1023 | 33 | DSNSE…QQSLH → GKPLKPSHSLVRLKAWEAVP SLNKTQS in isoform 3 and isoform 4. | VSP_019301 | |||||
| Natural variant | 203 | 1 | A → P: dbSNP rs7732671. Ref.8 | VAR_026698 | |||||
| Natural variant | 265 | 1 | R → Q: dbSNP rs45520937. Ref.2 | VAR_026699 | |||||
| Natural variant | 279 | 1 | V → I: dbSNP rs17572019. Ref.8 | VAR_026700 | |||||
| Natural variant | 292 | 1 | R → S: dbSNP rs11959820. Ref.8 Ref.5 | VAR_026701 | |||||
Experimental info | |||||||||
| Mutagenesis | 92 – 96 | 5 | LLAEL → AAAEA: Reduces DNA transcriptional activity. | ||||||
| Mutagenesis | 155 – 160 | 6 | LLQKLL → AAQKAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 343-AREAA-347. Ref.1 | ||||||
| Mutagenesis | 343 – 347 | 5 | LRELL → AREAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 155-AAQKAA-160. Ref.1 | ||||||
| Sequence conflict | 558 | 1 | E → G in BAC04541. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha." Kressler D., Schreiber S.N., Knutti D., Kralli A. J. Biol. Chem. 277:13918-13925(2002) [PubMed: 11854298] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), SUBCELLULAR LOCATION, MOTIF, TISSUE SPECIFICITY, MUTAGENESIS OF 92-LEU--LEU-96; 155-LEU--LEU-160 AND 343-LEU--LEU-347, INTERACTION WITH ESR1, FUNCTION. |
| [2] | "Characterization of the human, mouse and rat PGC1 beta (peroxisome-proliferator-activated receptor-gamma co-activator 1 beta) gene in vitro and in vivo." Meirhaeghe A., Crowley V., Lenaghan C., Lelliott C., Green K., Stewart A., Hart K., Schinner S., Sethi J.K., Yeo G., Brand M.D., Cortright R.N., O'Rahilly S., Montague C., Vidal-Puig A.J. Biochem. J. 373:155-165(2003) [PubMed: 12678921] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, FUNCTION, VARIANT GLN-265. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Tongue. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-292. |
| [6] | "Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: potential role of PGC1 and NRF1." Patti M.E., Butte A.J., Crunkhorn S., Cusi K., Berria R., Kashyap S., Miyazaki Y., Kohane I., Costello M., Saccone R., Landaker E.J., Goldfine A.B., Mun E., DeFronzo R., Finlayson J., Kahn C.R., Mandarino L.J. Proc. Natl. Acad. Sci. U.S.A. 100:8466-8471(2003) [PubMed: 12832613] [Abstract] Cited for: INDUCTION. |
| [7] | "Multiple environmental and genetic factors influence skeletal muscle PGC-1alpha and PGC-1beta gene expression in twins." Ling C., Poulsen P., Carlsson E., Ridderstrale M., Almgren P., Wojtaszewski J., Beck-Nielsen H., Groop L., Vaag A. J. Clin. Invest. 114:1518-1526(2004) [PubMed: 15546003] [Abstract] Cited for: FUNCTION, INDUCTION BY INSULIN AND AGING. |
| [8] | "Evidence of an association between genetic variation of the coactivator PGC-1beta and obesity." Andersen G., Wegner L., Yanagisawa K., Rose C.S., Lin J., Gluemer C., Drivsholm T., Borch-Johnsen K., Jorgensen T., Hansen T., Spiegelman B.M., Pedersen O. J. Med. Genet. 42:402-407(2005) [PubMed: 15863669] [Abstract] Cited for: POLYMORPHISM, VARIANTS PRO-203; ILE-279 AND SER-292. |
| [9] | "Fatty acid-induced differential regulation of the genes encoding peroxisome proliferator-activated receptor-gamma coactivator-1alpha and -1beta in human skeletal muscle cells that have been differentiated in vitro." Staiger H., Staiger K., Haas C., Weisser M., Machicao F., Haering H.-U. Diabetologia 48:2115-2118(2005) [PubMed: 16132959] [Abstract] Cited for: REGULATION BY FATTY ACIDS. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-524, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF468496 mRNA. Translation: AAL78633.1. AF468497 mRNA. Translation: AAL78634.1. AY188947 mRNA. Translation: AAO40022.1. AY188948 mRNA. Translation: AAO40023.1. AY188949 mRNA. Translation: AAO40024.1. AY188950 mRNA. Translation: AAO40025.1. AK095391 mRNA. Translation: BAC04541.1. CH471062 Genomic DNA. Translation: EAW61759.1. BC132971 mRNA. Translation: AAI32972.1. BC132973 mRNA. Translation: AAI32974.1. |
| IPI | IPI00152517. IPI00163514. IPI00759533. IPI00759561. IPI00759685. |
| RefSeq | NP_573570.2. |
| UniGene | Hs.591261 |
3D structure databases | |
| SMR | Q86YN6. Positions 899-957. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q86YN6. |
PTM databases | |
| PhosphoSite | Q86YN6. |
Proteomic databases | |
| PRIDE | Q86YN6. |
Genome annotation databases | |
| Ensembl | ENST00000309241; ENSP00000312649; ENSG00000155846; Homo sapiens. [Genome view] |
| GeneID | 133522. |
| KEGG | hsa:133522. |
| UCSC | uc003lrb.1. human. uc003lrd.1. human. uc003lre.1. human. uc003lrf.1. human. |
Organism-specific databases | |
| CTD | 133522. |
| GeneCards | GC05P149090. |
| H-InvDB | HIX0005305. |
| HGNC | HGNC:30022. PPARGC1B. |
| MIM | 608886. gene. |
| PharmGKB | PA134953410. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q86YN6. |
| InParanoid | Q86YN6. |
| OMA | DHDYCQV. |
| OrthoDB | EOG9ZPHF4. |
| PhylomeDB | Q86YN6. |
Gene expression databases | |
| ArrayExpress | Q86YN6. |
| Bgee | Q86YN6. |
| CleanEx | HS_PPARGC1B. |
| Genevestigator | Q86YN6. |
Family and domain databases | |
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR000504. RRM_RNP1. [Graphical view] |
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. |
| Pfam | PF00076. RRM_1. 1 hit. [Graphical view] |
| SMART | SM00360. RRM. 1 hit. [Graphical view] |
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 83227. |
| SOURCE | Search... |
Entry information
| Entry name | PRGC2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86YN6 Secondary accession number(s): A2RUM8 Q8TDE5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


