SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86YN6

- PRGC2_HUMAN

UniProt

Q86YN6 - PRGC2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Peroxisome proliferator-activated receptor gamma coactivator 1-beta
Gene
PPARGC1B, PERC, PGC1, PGC1B, PPARGC1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcritional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner.4 Publications

GO - Molecular functioni

  1. AF-2 domain binding Source: UniProtKB
  2. RNA binding Source: UniProtKB
  3. RNA polymerase II transcription cofactor activity Source: UniProtKB
  4. estrogen receptor binding Source: UniProtKB
  5. ligand-dependent nuclear receptor transcription coactivator activity Source: UniProtKB
  6. nucleotide binding Source: InterPro
  7. receptor activator activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. actin filament organization Source: Ensembl
  2. bone trabecula formation Source: Ensembl
  3. cellular lipid metabolic process Source: Reactome
  4. cellular response to reactive oxygen species Source: Ensembl
  5. intracellular estrogen receptor signaling pathway Source: UniProtKB
  6. negative regulation of transcription, DNA-templated Source: Ensembl
  7. ossification Source: Ensembl
  8. positive regulation of alkaline phosphatase activity Source: Ensembl
  9. positive regulation of bone resorption Source: Ensembl
  10. positive regulation of osteoclast differentiation Source: Ensembl
  11. positive regulation of phosphorylation Source: Ensembl
  12. positive regulation of receptor activity Source: GOC
  13. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  14. regulation of transcription, DNA-templated Source: UniProtKB
  15. response to cAMP Source: Ensembl
  16. response to glucocorticoid Source: Ensembl
  17. small molecule metabolic process Source: Reactome
  18. transcription from RNA polymerase II promoter Source: GOC
  19. transcription from mitochondrial promoter Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiREACT_116145. PPARA activates gene expression.
REACT_200608. Transcriptional activation of mitochondrial biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Peroxisome proliferator-activated receptor gamma coactivator 1-beta
Short name:
PGC-1-beta
Short name:
PPAR-gamma coactivator 1-beta
Short name:
PPARGC-1-beta
Alternative name(s):
PGC-1-related estrogen receptor alpha coactivator
Gene namesi
Synonyms:PERC, PGC1, PGC1B, PPARGC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:30022. PPARGC1B.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. mediator complex Source: UniProtKB
  2. mitochondrion Source: GOC
  3. nucleoplasm Source: Reactome
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi92 – 965LLAEL → AAAEA: Reduces DNA transcriptional activity.
Mutagenesisi155 – 1606LLQKLL → AAQKAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 343-AREAA-347. 1 Publication
Mutagenesisi343 – 3475LRELL → AREAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 155-AAQKAA-160. 1 Publication

Organism-specific databases

PharmGKBiPA134953410.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10231023Peroxisome proliferator-activated receptor gamma coactivator 1-beta
PRO_0000240158Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei524 – 5241Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ86YN6.
PRIDEiQ86YN6.

PTM databases

PhosphoSiteiQ86YN6.

Expressioni

Tissue specificityi

Ubiquitous with higher expression in heart, brain and skeletal muscle.2 Publications

Inductioni

Repressed by saturated fatty acids such as palmitate and stearate in skeletal muscle cells. Induced by insulin and reduced by aging in skeletal muscle biopsies. Down-regulated in type 2 diabetes mellitus subjects as well as in pre-diabetics.3 Publications

Gene expression databases

BgeeiQ86YN6.
CleanExiHS_PPARGC1B.
GenevestigatoriQ86YN6.

Interactioni

Subunit structurei

Interacts with hepatocyte nuclear factor 4-alpha/HNF4A, Sterol regulatory binding transcription factor 1/SREBF1, PPAR-alpha/PPARA, thyroid hormone receptor beta/THRB and host cell factor/HCFC1. Interacts with estrogen-related receptor gamma/ESRRG and alpha/ESRRA. Interacts with PRDM16 By similarity. Interacts with estrogen receptor alpha/ESR1.1 Publication

Protein-protein interaction databases

BioGridi126361. 17 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi155 – 1628

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3SP6X-ray2.21B153-163[»]
ProteinModelPortaliQ86YN6.
SMRiQ86YN6. Positions 903-964.

Miscellaneous databases

EvolutionaryTraceiQ86YN6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini902 – 97675RRM
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 9191Abolishes DNA transcriptional activity when missing
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi156 – 1605LXXLL motif 1
Motifi343 – 3475LXXLL motif 2
Motifi691 – 6944HCFC1-binding-motif (HBM)

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi430 – 45021Glu-rich
Add
BLAST
Compositional biasi772 – 82352Glu-rich
Add
BLAST

Domaini

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG87590.
HOGENOMiHOG000236356.
HOVERGENiHBG080730.
InParanoidiQ86YN6.
KOiK17962.
OMAiCESGCGD.
OrthoDBiEOG7S4X5H.
PhylomeDBiQ86YN6.
TreeFamiTF343068.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86YN6-1) [UniParc]FASTAAdd to Basket

Also known as: PGC1beta-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAGNDCGALL DEELSSFFLN YLADTQGGGS GEEQLYADFP ELDLSQLDAS     50
DFDSATCFGE LQWCPENSET EPNQYSPDDS ELFQIDSENE ALLAELTKTL 100
DDIPEDDVGL AAFPALDGGD ALSCTSASPA PSSAPPSPAP EKPSAPAPEV 150
DELSLLQKLL LATSYPTSSS DTQKEGTAWR QAGLRSKSQR PCVKADSTQD 200
KKAPMMQSQS RSCTELHKHL TSAQCCLQDR GLQPPCLQSP RLPAKEDKEP 250
GEDCPSPQPA PASPRDSLAL GRADPGAPVS QEDMQAMVQL IRYMHTYCLP 300
QRKLPPQTPE PLPKACSNPS QQVRSRPWSR HHSKASWAEF SILRELLAQD 350
VLCDVSKPYR LATPVYASLT PRSRPRPPKD SQASPGRPSS VEEVRIAASP 400
KSTGPRPSLR PLRLEVKREV RRPARLQQQE EEDEEEEEEE EEEEKEEEEE 450
WGRKRPGRGL PWTKLGRKLE SSVCPVRRSR RLNPELGPWL TFADEPLVPS 500
EPQGALPSLC LAPKAYDVER ELGSPTDEDS GQDQQLLRGP QIPALESPCE 550
SGCGDMDEDP SCPQLPPRDS PRCLMLALSQ SDPTFGKKSF EQTLTVELCG 600
TAGLTPPTTP PYKPTEEDPF KPDIKHSLGK EIALSLPSPE GLSLKATPGA 650
AHKLPKKHPE RSELLSHLRH ATAQPASQAG QKRPFSCSFG DHDYCQVLRP 700
EGVLQRKVLR SWEPSGVHLE DWPQQGAPWA EAQAPGREED RSCDAGAPPK 750
DSTLLRDHEI RASLTKHFGL LETALEEEDL ASCKSPEYDT VFEDSSSSSG 800
ESSFLPEEEE EEGEEEEEDD EEEDSGVSPT CSDHCPYQSP PSKANRQLCS 850
RSRSSSGSSP CHSWSPATRR NFRCESRGPC SDRTPSIRHA RKRREKAIGE 900
GRVVYIQNLS SDMSSRELKR RFEVFGEIEE CEVLTRNRRG EKYGFITYRC 950
SEHAALSLTK GAALRKRNEP SFQLSYGGLR HFCWPRYTDY DSNSEEALPA 1000
SGKSKYEAMD FDSLLKEAQQ SLH 1023
Length:1,023
Mass (Da):113,222
Last modified:October 17, 2006 - v2
Checksum:iDC37FCDE4D3CD239
GO
Isoform 2 (identifier: Q86YN6-2) [UniParc]FASTAAdd to Basket

Also known as: PGC1beta-2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK

Show »
Length:1,002
Mass (Da):110,981
Checksum:i8ACBD368E172B27E
GO
Isoform 3 (identifier: Q86YN6-3) [UniParc]FASTAAdd to Basket

Also known as: PGC1beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS

Show »
Length:1,017
Mass (Da):112,568
Checksum:iF2229A0A356A2148
GO
Isoform 4 (identifier: Q86YN6-4) [UniParc]FASTAAdd to Basket

Also known as: PGC1beta-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK
     991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS

Show »
Length:996
Mass (Da):110,327
Checksum:i5265F3916B919ECC
GO
Isoform 5 (identifier: Q86YN6-5) [UniParc]FASTAAdd to Basket

Also known as: PERC-s

The sequence of this isoform differs from the canonical sequence as follows:
     156-194: Missing.

Note: Lacks LXXLL motif 1 and has a reduced ability to enhance the hormone-dependent activity of estrogen receptor alpha.

Show »
Length:984
Mass (Da):108,919
Checksum:i5D91928FD6D6D104
GO
Isoform 6 (identifier: Q86YN6-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MAGNDCGALLDEELSSFFLNYLADTQ → M
     156-194: Missing.

Note: No experimental confirmation available.

Show »
Length:959
Mass (Da):106,230
Checksum:iD4E5EF57FC0C2459
GO

Polymorphismi

Variation of PPARGC1B may contribute to the pathogenesis of obesity, with a widespread Ala-203 allele being a risk factor for the development of this common disorders.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti203 – 2031A → P.1 Publication
Corresponds to variant rs7732671 [ dbSNP | Ensembl ].
VAR_026698
Natural varianti265 – 2651R → Q.1 Publication
Corresponds to variant rs45520937 [ dbSNP | Ensembl ].
VAR_026699
Natural varianti279 – 2791V → I.1 Publication
Corresponds to variant rs17572019 [ dbSNP | Ensembl ].
VAR_026700
Natural varianti292 – 2921R → S.2 Publications
Corresponds to variant rs11959820 [ dbSNP | Ensembl ].
VAR_026701

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2626MAGND…LADTQ → MGVYK in isoform 2 and isoform 4.
VSP_019299Add
BLAST
Alternative sequencei1 – 2626MAGND…LADTQ → M in isoform 6.
VSP_043374Add
BLAST
Alternative sequencei156 – 19439Missing in isoform 5 and isoform 6.
VSP_019300Add
BLAST
Alternative sequencei991 – 102333DSNSE…QQSLH → GKPLKPSHSLVRLKAWEAVP SLNKTQS in isoform 3 and isoform 4.
VSP_019301Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti558 – 5581E → G in BAC04541. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF468496 mRNA. Translation: AAL78633.1.
AF468497 mRNA. Translation: AAL78634.1.
AY188947 mRNA. Translation: AAO40022.1.
AY188948 mRNA. Translation: AAO40023.1.
AY188949 mRNA. Translation: AAO40024.1.
AY188950 mRNA. Translation: AAO40025.1.
AK095391 mRNA. Translation: BAC04541.1.
AK123614 mRNA. Translation: BAG53922.1.
AC008545 Genomic DNA. No translation available.
AC022100 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61759.1.
BC132971 mRNA. Translation: AAI32972.1.
BC132973 mRNA. Translation: AAI32974.1.
CCDSiCCDS4298.1. [Q86YN6-1]
CCDS54933.1. [Q86YN6-5]
CCDS54934.1. [Q86YN6-6]
RefSeqiNP_001166169.1. NM_001172698.1. [Q86YN6-5]
NP_001166170.1. NM_001172699.1. [Q86YN6-6]
NP_573570.3. NM_133263.3. [Q86YN6-1]
XP_005268429.1. XM_005268372.2. [Q86YN6-2]
UniGeneiHs.483816.

Genome annotation databases

EnsembliENST00000309241; ENSP00000312649; ENSG00000155846. [Q86YN6-1]
ENST00000360453; ENSP00000353638; ENSG00000155846. [Q86YN6-5]
ENST00000394320; ENSP00000377855; ENSG00000155846. [Q86YN6-3]
ENST00000403750; ENSP00000384403; ENSG00000155846. [Q86YN6-6]
GeneIDi133522.
KEGGihsa:133522.
UCSCiuc003lrb.2. human. [Q86YN6-3]
uc003lrc.3. human. [Q86YN6-1]
uc003lrd.3. human. [Q86YN6-5]
uc003lre.1. human. [Q86YN6-4]
uc003lrf.3. human. [Q86YN6-2]
uc021yfr.1. human. [Q86YN6-6]

Polymorphism databases

DMDMi116242724.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF468496 mRNA. Translation: AAL78633.1 .
AF468497 mRNA. Translation: AAL78634.1 .
AY188947 mRNA. Translation: AAO40022.1 .
AY188948 mRNA. Translation: AAO40023.1 .
AY188949 mRNA. Translation: AAO40024.1 .
AY188950 mRNA. Translation: AAO40025.1 .
AK095391 mRNA. Translation: BAC04541.1 .
AK123614 mRNA. Translation: BAG53922.1 .
AC008545 Genomic DNA. No translation available.
AC022100 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61759.1 .
BC132971 mRNA. Translation: AAI32972.1 .
BC132973 mRNA. Translation: AAI32974.1 .
CCDSi CCDS4298.1. [Q86YN6-1 ]
CCDS54933.1. [Q86YN6-5 ]
CCDS54934.1. [Q86YN6-6 ]
RefSeqi NP_001166169.1. NM_001172698.1. [Q86YN6-5 ]
NP_001166170.1. NM_001172699.1. [Q86YN6-6 ]
NP_573570.3. NM_133263.3. [Q86YN6-1 ]
XP_005268429.1. XM_005268372.2. [Q86YN6-2 ]
UniGenei Hs.483816.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3SP6 X-ray 2.21 B 153-163 [» ]
ProteinModelPortali Q86YN6.
SMRi Q86YN6. Positions 903-964.
ModBasei Search...

Protein-protein interaction databases

BioGridi 126361. 17 interactions.

PTM databases

PhosphoSitei Q86YN6.

Polymorphism databases

DMDMi 116242724.

Proteomic databases

PaxDbi Q86YN6.
PRIDEi Q86YN6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000309241 ; ENSP00000312649 ; ENSG00000155846 . [Q86YN6-1 ]
ENST00000360453 ; ENSP00000353638 ; ENSG00000155846 . [Q86YN6-5 ]
ENST00000394320 ; ENSP00000377855 ; ENSG00000155846 . [Q86YN6-3 ]
ENST00000403750 ; ENSP00000384403 ; ENSG00000155846 . [Q86YN6-6 ]
GeneIDi 133522.
KEGGi hsa:133522.
UCSCi uc003lrb.2. human. [Q86YN6-3 ]
uc003lrc.3. human. [Q86YN6-1 ]
uc003lrd.3. human. [Q86YN6-5 ]
uc003lre.1. human. [Q86YN6-4 ]
uc003lrf.3. human. [Q86YN6-2 ]
uc021yfr.1. human. [Q86YN6-6 ]

Organism-specific databases

CTDi 133522.
GeneCardsi GC05P149109.
HGNCi HGNC:30022. PPARGC1B.
MIMi 608886. gene.
neXtProti NX_Q86YN6.
PharmGKBi PA134953410.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG87590.
HOGENOMi HOG000236356.
HOVERGENi HBG080730.
InParanoidi Q86YN6.
KOi K17962.
OMAi CESGCGD.
OrthoDBi EOG7S4X5H.
PhylomeDBi Q86YN6.
TreeFami TF343068.

Enzyme and pathway databases

Reactomei REACT_116145. PPARA activates gene expression.
REACT_200608. Transcriptional activation of mitochondrial biogenesis.

Miscellaneous databases

EvolutionaryTracei Q86YN6.
GeneWikii PPARGC1B.
GenomeRNAii 133522.
NextBioi 83227.
PROi Q86YN6.
SOURCEi Search...

Gene expression databases

Bgeei Q86YN6.
CleanExi HS_PPARGC1B.
Genevestigatori Q86YN6.

Family and domain databases

Gene3Di 3.30.70.330. 1 hit.
InterProi IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view ]
Pfami PF00076. RRM_1. 1 hit.
[Graphical view ]
SMARTi SM00360. RRM. 1 hit.
[Graphical view ]
PROSITEi PS50102. RRM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha."
    Kressler D., Schreiber S.N., Knutti D., Kralli A.
    J. Biol. Chem. 277:13918-13925(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), SUBCELLULAR LOCATION, MOTIF, TISSUE SPECIFICITY, MUTAGENESIS OF 92-LEU--LEU-96; 155-LEU--LEU-160 AND 343-LEU--LEU-347, INTERACTION WITH ESR1, FUNCTION.
  2. "Characterization of the human, mouse and rat PGC1 beta (peroxisome-proliferator-activated receptor-gamma co-activator 1 beta) gene in vitro and in vivo."
    Meirhaeghe A., Crowley V., Lenaghan C., Lelliott C., Green K., Stewart A., Hart K., Schinner S., Sethi J.K., Yeo G., Brand M.D., Cortright R.N., O'Rahilly S., Montague C., Vidal-Puig A.J.
    Biochem. J. 373:155-165(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, FUNCTION, VARIANT GLN-265.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6).
    Tissue: Tongue.
  4. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-292.
  7. "Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: potential role of PGC1 and NRF1."
    Patti M.E., Butte A.J., Crunkhorn S., Cusi K., Berria R., Kashyap S., Miyazaki Y., Kohane I., Costello M., Saccone R., Landaker E.J., Goldfine A.B., Mun E., DeFronzo R., Finlayson J., Kahn C.R., Mandarino L.J.
    Proc. Natl. Acad. Sci. U.S.A. 100:8466-8471(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  8. "Multiple environmental and genetic factors influence skeletal muscle PGC-1alpha and PGC-1beta gene expression in twins."
    Ling C., Poulsen P., Carlsson E., Ridderstrale M., Almgren P., Wojtaszewski J., Beck-Nielsen H., Groop L., Vaag A.
    J. Clin. Invest. 114:1518-1526(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INDUCTION BY INSULIN AND AGING.
  9. "Evidence of an association between genetic variation of the coactivator PGC-1beta and obesity."
    Andersen G., Wegner L., Yanagisawa K., Rose C.S., Lin J., Gluemer C., Drivsholm T., Borch-Johnsen K., Jorgensen T., Hansen T., Spiegelman B.M., Pedersen O.
    J. Med. Genet. 42:402-407(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM, VARIANTS PRO-203; ILE-279 AND SER-292.
  10. "Fatty acid-induced differential regulation of the genes encoding peroxisome proliferator-activated receptor-gamma coactivator-1alpha and -1beta in human skeletal muscle cells that have been differentiated in vitro."
    Staiger H., Staiger K., Haas C., Weisser M., Machicao F., Haering H.-U.
    Diabetologia 48:2115-2118(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: REGULATION BY FATTY ACIDS.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-524, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells."
    Cho Y., Hazen B.C., Russell A.P., Kralli A.
    J. Biol. Chem. 288:25207-25218(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiPRGC2_HUMAN
AccessioniPrimary (citable) accession number: Q86YN6
Secondary accession number(s): A2RUM8
, A2RUN0, B3KVW0, Q86YN3, Q86YN4, Q86YN5, Q8N1N9, Q8TDE4, Q8TDE5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: October 17, 2006
Last modified: September 3, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi