Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86YF9

- DZIP1_HUMAN

UniProt

Q86YF9 - DZIP1_HUMAN

Protein

Zinc finger protein DZIP1

Gene

DZIP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 1 (01 Jun 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May participate in spermatogenesis via its interaction with DAZ.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri198 – 22124C2H2-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. cilium assembly Source: BHF-UCL
    2. germ cell development Source: UniProtKB
    3. multicellular organismal development Source: UniProtKB-KW
    4. spermatogenesis Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Spermatogenesis

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein DZIP1
    Alternative name(s):
    DAZ-interacting protein 1/2
    Gene namesi
    Name:DZIP1
    Synonyms:DZIP, DZIP2, KIAA0996
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:20908. DZIP1.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasm 1 Publication
    Note: In testis, it is predominantly nuclear, with some cytoplasmic localization in spermatogonia. Colocalizes with DAZ and DAZL in primordial germ cells.

    GO - Cellular componenti

    1. ciliary basal body Source: BHF-UCL
    2. cytoplasm Source: UniProtKB
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134960194.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 867867Zinc finger protein DZIP1PRO_0000047106Add
    BLAST

    Proteomic databases

    PaxDbiQ86YF9.
    PRIDEiQ86YF9.

    PTM databases

    PhosphoSiteiQ86YF9.

    Expressioni

    Tissue specificityi

    Predominantly expressed in testis. Also expressed in fetal brain, adult oocytes and ovary. Expressed in undifferentiated ES cells. In testis, it is probably specifically expressed in germ cells. Expressed in mature germ cells and secondary spermatocytes, while it is weakly or not expressed in primary spermatocytes.1 Publication

    Gene expression databases

    ArrayExpressiQ86YF9.
    BgeeiQ86YF9.
    CleanExiHS_DZIP1.
    GenevestigatoriQ86YF9.

    Organism-specific databases

    HPAiHPA054891.
    HPA057272.

    Interactioni

    Subunit structurei

    Isoform 1 and isoform 2 interact with DAZ proteins. May participate in an RNA-binding complex that functions in both ES cells and germ cells.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PPP2R5EQ165373EBI-998108,EBI-968374

    Protein-protein interaction databases

    BioGridi116540. 2 interactions.
    IntActiQ86YF9. 8 interactions.
    STRINGi9606.ENSP00000257312.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86YF9.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili230 – 340111Sequence AnalysisAdd
    BLAST
    Coiled coili401 – 44545Sequence AnalysisAdd
    BLAST
    Coiled coili568 – 58821Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2H2-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri198 – 22124C2H2-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG79110.
    HOVERGENiHBG059529.
    InParanoidiQ86YF9.
    KOiK16470.
    OMAiNSALEYQ.
    OrthoDBiEOG7N0C3X.
    PhylomeDBiQ86YF9.
    TreeFamiTF330044.

    Family and domain databases

    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 1 hit.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 1 hit.
    PS50157. ZINC_FINGER_C2H2_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86YF9-1) [UniParc]FASTAAdd to Basket

    Also known as: DZIPt2, DZIP testis 2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQAEAADWFS SMPFQKHVYY PLASGPEGPD VAVAAAAAGA ASMACAPPSA    50
    ASGPLPFFQF RPRLESVDWR RLSAIDVDKV AGAVDVLTLQ ENIMNITFCK 100
    LEDEKCPHCQ SGVDPVLLKL IRLAQFTIEY LLHSQEFLTS QLHTLEERLR 150
    LSHCDGEQSK KLLTKQAGEI KTLKEECKRR KKMISTQQLM IEAKANYYQC 200
    HFCDKAFMNQ AFLQSHIQRR HTEENSHFEY QKNAQIEKLR SEIVVLKEEL 250
    QLTRSELEAA HHASAVRFSK EYEMQKTKEE DFLKLFDRWK EEEKEKLVDE 300
    MEKVKEMFMK EFKELTSKNS ALEYQLSEIQ KSNMQIKSNI GTLKDAHEFK 350
    EDRSPYPQDF HNVMQLLDSQ ESKWTARVQA IHQEHKKEKG RLLSHIEKLR 400
    TSMIDDLNAS NVFYKKRIEE LGQRLQEQNE LIITQRQQIK DFTCNPLNSI 450
    SEPKGNPLAW QAFESQPAAP AVPMNAPALH TLETKSSLPM VHEQAFSSHI 500
    LEPIEELSEE EKGRENEQKL NNNKMHLRKA LKSNSSLTKG LRTMVEQNLM 550
    EKLETLGINA DIRGISSDQL HRVLKSVESE RHKQEREIPN FHQIREFLEH 600
    QVSCKIEEKA LLSSDQCSVS QMDTLSTGEV PKMIQLPSKN RQLIRQKAVS 650
    TDRTSVPKIK KNVMEDPFPR KSSTITTPPF SSEEEQEDDD LIRAYASPGP 700
    LPVPPPQNKG SFGKNTVKSD ADGTEGSEIE DTDDSPKPAG VAVKTPTEKV 750
    EKMFPHRKNV NKPVGGTNVP EMFIKKEELQ ELKCADVEDE DWDISSLEEE 800
    ISLGKKSGKE QKEPPPAKNE PHFAHVLNAW GAFNPKGPKG EGLQENESST 850
    LKSSLVTVTD WSDTSDV 867
    Length:867
    Mass (Da):98,664
    Last modified:June 1, 2003 - v1
    Checksum:i4C5A7B9438D40623
    GO
    Isoform 2 (identifier: Q86YF9-2) [UniParc]FASTAAdd to Basket

    Also known as: DZIPt1, DZIP testis 1

    The sequence of this isoform differs from the canonical sequence as follows:
         455-474: GNPLAWQAFESQPAAPAVPM → V

    Show »
    Length:848
    Mass (Da):96,698
    Checksum:i846EAAA465692C75
    GO
    Isoform 3 (identifier: Q86YF9-3) [UniParc]FASTAAdd to Basket

    Also known as: DZIPb, DZIP brain

    The sequence of this isoform differs from the canonical sequence as follows:
         12-12: M → MVRGGRPGRPRRGCRAGENRGFPGPPAPQPARPPSPPPAALSLCPPQ
         229-231: EYQ → GHL
         232-867: Missing.

    Show »
    Length:277
    Mass (Da):30,798
    Checksum:i3647AE58F3E2915A
    GO

    Sequence cautioni

    The sequence AAL36978.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence BAA76840.2 differs from that shown. Reason: Erroneous initiation.
    The sequence CAB43211.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti615 – 6151D → G in CAB43211. (PubMed:17974005)Curated
    Sequence conflicti818 – 8192KN → EK in CAB43211. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti172 – 1721T → M.
    Corresponds to variant rs9561921 [ dbSNP | Ensembl ].
    VAR_052710
    Natural varianti664 – 6641M → L.
    Corresponds to variant rs34303958 [ dbSNP | Ensembl ].
    VAR_052711
    Natural varianti736 – 7361P → S.1 Publication
    Corresponds to variant rs11070136 [ dbSNP | Ensembl ].
    VAR_019456

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei12 – 121M → MVRGGRPGRPRRGCRAGENR GFPGPPAPQPARPPSPPPAA LSLCPPQ in isoform 3. 1 PublicationVSP_010962
    Alternative sequencei229 – 2313EYQ → GHL in isoform 3. 1 PublicationVSP_010963
    Alternative sequencei232 – 867636Missing in isoform 3. 1 PublicationVSP_010964Add
    BLAST
    Alternative sequencei455 – 47420GNPLA…PAVPM → V in isoform 2. 1 PublicationVSP_010965Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF272347 mRNA. Translation: AAL36978.1. Sequence problems.
    AF272348 mRNA. Translation: AAL36979.1.
    AB023213 mRNA. Translation: BAA76840.2. Different initiation.
    AL139376 Genomic DNA. Translation: CAH71600.1.
    AL139376 Genomic DNA. Translation: CAH71601.1.
    BC041804 mRNA. Translation: AAH41804.1.
    AL049931 mRNA. Translation: CAB43211.2. Different initiation.
    CCDSiCCDS9477.1. [Q86YF9-2]
    CCDS9478.1. [Q86YF9-1]
    PIRiT08668.
    RefSeqiNP_055749.1. NM_014934.4. [Q86YF9-2]
    NP_945319.1. NM_198968.3. [Q86YF9-1]
    UniGeneiHs.656580.
    Hs.742077.

    Genome annotation databases

    EnsembliENST00000347108; ENSP00000257312; ENSG00000134874. [Q86YF9-1]
    ENST00000361156; ENSP00000355018; ENSG00000134874. [Q86YF9-2]
    ENST00000361396; ENSP00000355175; ENSG00000134874. [Q86YF9-2]
    ENST00000376829; ENSP00000366025; ENSG00000134874. [Q86YF9-1]
    ENST00000466569; ENSP00000431168; ENSG00000134874. [Q86YF9-3]
    GeneIDi22873.
    KEGGihsa:22873.
    UCSCiuc001vmk.4. human. [Q86YF9-1]
    uc001vml.4. human. [Q86YF9-2]

    Polymorphism databases

    DMDMi50400485.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF272347 mRNA. Translation: AAL36978.1 . Sequence problems.
    AF272348 mRNA. Translation: AAL36979.1 .
    AB023213 mRNA. Translation: BAA76840.2 . Different initiation.
    AL139376 Genomic DNA. Translation: CAH71600.1 .
    AL139376 Genomic DNA. Translation: CAH71601.1 .
    BC041804 mRNA. Translation: AAH41804.1 .
    AL049931 mRNA. Translation: CAB43211.2 . Different initiation.
    CCDSi CCDS9477.1. [Q86YF9-2 ]
    CCDS9478.1. [Q86YF9-1 ]
    PIRi T08668.
    RefSeqi NP_055749.1. NM_014934.4. [Q86YF9-2 ]
    NP_945319.1. NM_198968.3. [Q86YF9-1 ]
    UniGenei Hs.656580.
    Hs.742077.

    3D structure databases

    ProteinModelPortali Q86YF9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116540. 2 interactions.
    IntActi Q86YF9. 8 interactions.
    STRINGi 9606.ENSP00000257312.

    PTM databases

    PhosphoSitei Q86YF9.

    Polymorphism databases

    DMDMi 50400485.

    Proteomic databases

    PaxDbi Q86YF9.
    PRIDEi Q86YF9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000347108 ; ENSP00000257312 ; ENSG00000134874 . [Q86YF9-1 ]
    ENST00000361156 ; ENSP00000355018 ; ENSG00000134874 . [Q86YF9-2 ]
    ENST00000361396 ; ENSP00000355175 ; ENSG00000134874 . [Q86YF9-2 ]
    ENST00000376829 ; ENSP00000366025 ; ENSG00000134874 . [Q86YF9-1 ]
    ENST00000466569 ; ENSP00000431168 ; ENSG00000134874 . [Q86YF9-3 ]
    GeneIDi 22873.
    KEGGi hsa:22873.
    UCSCi uc001vmk.4. human. [Q86YF9-1 ]
    uc001vml.4. human. [Q86YF9-2 ]

    Organism-specific databases

    CTDi 22873.
    GeneCardsi GC13M096230.
    HGNCi HGNC:20908. DZIP1.
    HPAi HPA054891.
    HPA057272.
    MIMi 608671. gene.
    neXtProti NX_Q86YF9.
    PharmGKBi PA134960194.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG79110.
    HOVERGENi HBG059529.
    InParanoidi Q86YF9.
    KOi K16470.
    OMAi NSALEYQ.
    OrthoDBi EOG7N0C3X.
    PhylomeDBi Q86YF9.
    TreeFami TF330044.

    Miscellaneous databases

    ChiTaRSi DZIP1. human.
    GeneWikii DZIP1.
    GenomeRNAii 22873.
    NextBioi 43419.
    PROi Q86YF9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q86YF9.
    Bgeei Q86YF9.
    CleanExi HS_DZIP1.
    Genevestigatori Q86YF9.

    Family and domain databases

    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 1 hit.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 1 hit.
    PS50157. ZINC_FINGER_C2H2_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins."
      Moore F.L., Jaruzelska J., Fox M.S., Urano J., Firpo M.T., Turek P.J., Dorfman D.M., Reijo Pera R.A.
      Proc. Natl. Acad. Sci. U.S.A. 100:538-543(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE OF 1-776 (ISOFORM 1), INTERACTION WITH DAZ.
    2. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 615-867, VARIANT SER-736.
      Tissue: Brain.
    6. "Identification of a novel gene, DZIP (DAZ-interacting protein), that encodes a protein that interacts with DAZ (deleted in azoospermia) and is expressed in embryonic stem cells and germ cells."
      Moore F.L., Jaruzelska J., Dorfman D.M., Reijo-Pera R.A.
      Genomics 83:834-843(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, INTERACTION WITH DAZ.

    Entry informationi

    Entry nameiDZIP1_HUMAN
    AccessioniPrimary (citable) accession number: Q86YF9
    Secondary accession number(s): Q5W078
    , Q5W079, Q8WY45, Q8WY46, Q9UGA5, Q9Y2K0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: June 1, 2003
    Last modified: October 1, 2014
    This is version 97 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3