Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein DZIP1

Gene

DZIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May participate in spermatogenesis via its interaction with DAZ (PubMed:15081113). Has a role in primary cilium formation (PubMed:19852954).2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri198 – 221C2H2-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

  • cilium assembly Source: BHF-UCL
  • cytoplasmic sequestering of protein Source: Ensembl
  • establishment of protein localization Source: Ensembl
  • germ cell development Source: UniProtKB
  • multicellular organism development Source: UniProtKB-KW
  • smoothened signaling pathway Source: Ensembl
  • spermatogenesis Source: UniProtKB-KW

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-5632684 Hedgehog 'on' state

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein DZIP1
Alternative name(s):
DAZ-interacting protein 1/2
Gene namesi
Name:DZIP1
Synonyms:DZIP, DZIP2, KIAA0996
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000134874.17
HGNCiHGNC:20908 DZIP1
MIMi608671 gene
neXtProtiNX_Q86YF9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi22873
OpenTargetsiENSG00000134874
PharmGKBiPA134960194

Polymorphism and mutation databases

BioMutaiDZIP1
DMDMi50400485

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000471061 – 867Zinc finger protein DZIP1Add BLAST867

Proteomic databases

EPDiQ86YF9
PaxDbiQ86YF9
PeptideAtlasiQ86YF9
PRIDEiQ86YF9

PTM databases

iPTMnetiQ86YF9
PhosphoSitePlusiQ86YF9

Expressioni

Tissue specificityi

Predominantly expressed in testis. Also expressed in fetal brain, adult oocytes and ovary. Expressed in undifferentiated ES cells. In testis, it is probably specifically expressed in germ cells. Expressed in mature germ cells and secondary spermatocytes, while it is weakly or not expressed in primary spermatocytes.1 Publication

Gene expression databases

BgeeiENSG00000134874
CleanExiHS_DZIP1
GenevisibleiQ86YF9 HS

Organism-specific databases

HPAiHPA054891
HPA057272
HPA070194

Interactioni

Subunit structurei

Isoform 1 and isoform 2 interact with DAZ proteins. May participate in an RNA-binding complex that functions in both ES cells and germ cells.

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi116540, 4 interactors
CORUMiQ86YF9
DIPiDIP-35710N
IntActiQ86YF9, 14 interactors
MINTiQ86YF9
STRINGi9606.ENSP00000257312

Structurei

3D structure databases

ProteinModelPortaliQ86YF9
SMRiQ86YF9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili230 – 340Sequence analysisAdd BLAST111
Coiled coili401 – 445Sequence analysisAdd BLAST45
Coiled coili568 – 588Sequence analysisAdd BLAST21

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri198 – 221C2H2-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IJJY Eukaryota
ENOG4111HTD LUCA
GeneTreeiENSGT00530000063572
HOVERGENiHBG059529
InParanoidiQ86YF9
KOiK16470
OMAiNSALEYQ
OrthoDBiEOG091G0R9K
PhylomeDBiQ86YF9
TreeFamiTF330044

Family and domain databases

InterProiView protein in InterPro
IPR032714 DZIP1_N
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF13815 Dzip-like_N, 1 hit
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 1 hit
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86YF9-1) [UniParc]FASTAAdd to basket
Also known as: DZIPt2, DZIP testis 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAEAADWFS SMPFQKHVYY PLASGPEGPD VAVAAAAAGA ASMACAPPSA
60 70 80 90 100
ASGPLPFFQF RPRLESVDWR RLSAIDVDKV AGAVDVLTLQ ENIMNITFCK
110 120 130 140 150
LEDEKCPHCQ SGVDPVLLKL IRLAQFTIEY LLHSQEFLTS QLHTLEERLR
160 170 180 190 200
LSHCDGEQSK KLLTKQAGEI KTLKEECKRR KKMISTQQLM IEAKANYYQC
210 220 230 240 250
HFCDKAFMNQ AFLQSHIQRR HTEENSHFEY QKNAQIEKLR SEIVVLKEEL
260 270 280 290 300
QLTRSELEAA HHASAVRFSK EYEMQKTKEE DFLKLFDRWK EEEKEKLVDE
310 320 330 340 350
MEKVKEMFMK EFKELTSKNS ALEYQLSEIQ KSNMQIKSNI GTLKDAHEFK
360 370 380 390 400
EDRSPYPQDF HNVMQLLDSQ ESKWTARVQA IHQEHKKEKG RLLSHIEKLR
410 420 430 440 450
TSMIDDLNAS NVFYKKRIEE LGQRLQEQNE LIITQRQQIK DFTCNPLNSI
460 470 480 490 500
SEPKGNPLAW QAFESQPAAP AVPMNAPALH TLETKSSLPM VHEQAFSSHI
510 520 530 540 550
LEPIEELSEE EKGRENEQKL NNNKMHLRKA LKSNSSLTKG LRTMVEQNLM
560 570 580 590 600
EKLETLGINA DIRGISSDQL HRVLKSVESE RHKQEREIPN FHQIREFLEH
610 620 630 640 650
QVSCKIEEKA LLSSDQCSVS QMDTLSTGEV PKMIQLPSKN RQLIRQKAVS
660 670 680 690 700
TDRTSVPKIK KNVMEDPFPR KSSTITTPPF SSEEEQEDDD LIRAYASPGP
710 720 730 740 750
LPVPPPQNKG SFGKNTVKSD ADGTEGSEIE DTDDSPKPAG VAVKTPTEKV
760 770 780 790 800
EKMFPHRKNV NKPVGGTNVP EMFIKKEELQ ELKCADVEDE DWDISSLEEE
810 820 830 840 850
ISLGKKSGKE QKEPPPAKNE PHFAHVLNAW GAFNPKGPKG EGLQENESST
860
LKSSLVTVTD WSDTSDV
Length:867
Mass (Da):98,664
Last modified:June 1, 2003 - v1
Checksum:i4C5A7B9438D40623
GO
Isoform 2 (identifier: Q86YF9-2) [UniParc]FASTAAdd to basket
Also known as: DZIPt1, DZIP testis 1

The sequence of this isoform differs from the canonical sequence as follows:
     455-474: GNPLAWQAFESQPAAPAVPM → V

Show »
Length:848
Mass (Da):96,698
Checksum:i846EAAA465692C75
GO
Isoform 3 (identifier: Q86YF9-3) [UniParc]FASTAAdd to basket
Also known as: DZIPb, DZIP brain

The sequence of this isoform differs from the canonical sequence as follows:
     12-12: M → MVRGGRPGRPRRGCRAGENRGFPGPPAPQPARPPSPPPAALSLCPPQ
     229-231: EYQ → GHL
     232-867: Missing.

Show »
Length:277
Mass (Da):30,798
Checksum:i3647AE58F3E2915A
GO

Sequence cautioni

The sequence AAL36978 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA76840 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB43211 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti615D → G in CAB43211 (PubMed:17974005).Curated1
Sequence conflicti818 – 819KN → EK in CAB43211 (PubMed:17974005).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052710172T → M. Corresponds to variant dbSNP:rs9561921Ensembl.1
Natural variantiVAR_052711664M → L. Corresponds to variant dbSNP:rs34303958Ensembl.1
Natural variantiVAR_019456736P → S1 PublicationCorresponds to variant dbSNP:rs11070136Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01096212M → MVRGGRPGRPRRGCRAGENR GFPGPPAPQPARPPSPPPAA LSLCPPQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_010963229 – 231EYQ → GHL in isoform 3. 1 Publication3
Alternative sequenceiVSP_010964232 – 867Missing in isoform 3. 1 PublicationAdd BLAST636
Alternative sequenceiVSP_010965455 – 474GNPLA…PAVPM → V in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF272347 mRNA Translation: AAL36978.1 Sequence problems.
AF272348 mRNA Translation: AAL36979.1
AB023213 mRNA Translation: BAA76840.2 Different initiation.
AL139376 Genomic DNA No translation available.
BC041804 mRNA Translation: AAH41804.1
AL049931 mRNA Translation: CAB43211.2 Different initiation.
CCDSiCCDS9477.1 [Q86YF9-2]
CCDS9478.1 [Q86YF9-1]
PIRiT08668
RefSeqiNP_055749.1, NM_014934.4 [Q86YF9-2]
NP_945319.1, NM_198968.3 [Q86YF9-1]
UniGeneiHs.656580
Hs.742077

Genome annotation databases

EnsembliENST00000347108; ENSP00000257312; ENSG00000134874 [Q86YF9-1]
ENST00000361156; ENSP00000355018; ENSG00000134874 [Q86YF9-2]
ENST00000361396; ENSP00000355175; ENSG00000134874 [Q86YF9-2]
ENST00000376829; ENSP00000366025; ENSG00000134874 [Q86YF9-1]
ENST00000466569; ENSP00000431168; ENSG00000134874 [Q86YF9-3]
GeneIDi22873
KEGGihsa:22873
UCSCiuc001vmk.5 human [Q86YF9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDZIP1_HUMAN
AccessioniPrimary (citable) accession number: Q86YF9
Secondary accession number(s): Q5W078
, Q5W079, Q8WY45, Q8WY46, Q9UGA5, Q9Y2K0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: June 1, 2003
Last modified: March 28, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health