SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86YF9

- DZIP1_HUMAN

UniProt

Q86YF9 - DZIP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc finger protein DZIP1
Gene
DZIP1, DZIP, DZIP2, KIAA0996
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May participate in spermatogenesis via its interaction with DAZ.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri198 – 22124C2H2-type
Add
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. cilium assembly Source: BHF-UCL
  2. germ cell development Source: UniProtKB
  3. multicellular organismal development Source: UniProtKB-KW
  4. spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein DZIP1
Alternative name(s):
DAZ-interacting protein 1/2
Gene namesi
Name:DZIP1
Synonyms:DZIP, DZIP2, KIAA0996
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:20908. DZIP1.

Subcellular locationi

Nucleus. Cytoplasm
Note: In testis, it is predominantly nuclear, with some cytoplasmic localization in spermatogonia. Colocalizes with DAZ and DAZL in primordial germ cells.1 Publication

GO - Cellular componenti

  1. ciliary basal body Source: BHF-UCL
  2. cytoplasm Source: UniProtKB
  3. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134960194.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 867867Zinc finger protein DZIP1
PRO_0000047106Add
BLAST

Proteomic databases

PaxDbiQ86YF9.
PRIDEiQ86YF9.

PTM databases

PhosphoSiteiQ86YF9.

Expressioni

Tissue specificityi

Predominantly expressed in testis. Also expressed in fetal brain, adult oocytes and ovary. Expressed in undifferentiated ES cells. In testis, it is probably specifically expressed in germ cells. Expressed in mature germ cells and secondary spermatocytes, while it is weakly or not expressed in primary spermatocytes.1 Publication

Gene expression databases

ArrayExpressiQ86YF9.
BgeeiQ86YF9.
CleanExiHS_DZIP1.
GenevestigatoriQ86YF9.

Organism-specific databases

HPAiHPA054891.
HPA057272.

Interactioni

Subunit structurei

Isoform 1 and isoform 2 interact with DAZ proteins. May participate in an RNA-binding complex that functions in both ES cells and germ cells.

Binary interactionsi

WithEntry#Exp.IntActNotes
PPP2R5EQ165373EBI-998108,EBI-968374

Protein-protein interaction databases

BioGridi116540. 2 interactions.
IntActiQ86YF9. 8 interactions.
STRINGi9606.ENSP00000257312.

Structurei

3D structure databases

ProteinModelPortaliQ86YF9.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili230 – 340111 Reviewed prediction
Add
BLAST
Coiled coili401 – 44545 Reviewed prediction
Add
BLAST
Coiled coili568 – 58821 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiNOG79110.
HOVERGENiHBG059529.
InParanoidiQ86YF9.
KOiK16470.
OMAiNSALEYQ.
OrthoDBiEOG7N0C3X.
PhylomeDBiQ86YF9.
TreeFamiTF330044.

Family and domain databases

InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 1 hit.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 1 hit.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86YF9-1) [UniParc]FASTAAdd to Basket

Also known as: DZIPt2, DZIP testis 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQAEAADWFS SMPFQKHVYY PLASGPEGPD VAVAAAAAGA ASMACAPPSA    50
ASGPLPFFQF RPRLESVDWR RLSAIDVDKV AGAVDVLTLQ ENIMNITFCK 100
LEDEKCPHCQ SGVDPVLLKL IRLAQFTIEY LLHSQEFLTS QLHTLEERLR 150
LSHCDGEQSK KLLTKQAGEI KTLKEECKRR KKMISTQQLM IEAKANYYQC 200
HFCDKAFMNQ AFLQSHIQRR HTEENSHFEY QKNAQIEKLR SEIVVLKEEL 250
QLTRSELEAA HHASAVRFSK EYEMQKTKEE DFLKLFDRWK EEEKEKLVDE 300
MEKVKEMFMK EFKELTSKNS ALEYQLSEIQ KSNMQIKSNI GTLKDAHEFK 350
EDRSPYPQDF HNVMQLLDSQ ESKWTARVQA IHQEHKKEKG RLLSHIEKLR 400
TSMIDDLNAS NVFYKKRIEE LGQRLQEQNE LIITQRQQIK DFTCNPLNSI 450
SEPKGNPLAW QAFESQPAAP AVPMNAPALH TLETKSSLPM VHEQAFSSHI 500
LEPIEELSEE EKGRENEQKL NNNKMHLRKA LKSNSSLTKG LRTMVEQNLM 550
EKLETLGINA DIRGISSDQL HRVLKSVESE RHKQEREIPN FHQIREFLEH 600
QVSCKIEEKA LLSSDQCSVS QMDTLSTGEV PKMIQLPSKN RQLIRQKAVS 650
TDRTSVPKIK KNVMEDPFPR KSSTITTPPF SSEEEQEDDD LIRAYASPGP 700
LPVPPPQNKG SFGKNTVKSD ADGTEGSEIE DTDDSPKPAG VAVKTPTEKV 750
EKMFPHRKNV NKPVGGTNVP EMFIKKEELQ ELKCADVEDE DWDISSLEEE 800
ISLGKKSGKE QKEPPPAKNE PHFAHVLNAW GAFNPKGPKG EGLQENESST 850
LKSSLVTVTD WSDTSDV 867
Length:867
Mass (Da):98,664
Last modified:June 1, 2003 - v1
Checksum:i4C5A7B9438D40623
GO
Isoform 2 (identifier: Q86YF9-2) [UniParc]FASTAAdd to Basket

Also known as: DZIPt1, DZIP testis 1

The sequence of this isoform differs from the canonical sequence as follows:
     455-474: GNPLAWQAFESQPAAPAVPM → V

Show »
Length:848
Mass (Da):96,698
Checksum:i846EAAA465692C75
GO
Isoform 3 (identifier: Q86YF9-3) [UniParc]FASTAAdd to Basket

Also known as: DZIPb, DZIP brain

The sequence of this isoform differs from the canonical sequence as follows:
     12-12: M → MVRGGRPGRPRRGCRAGENRGFPGPPAPQPARPPSPPPAALSLCPPQ
     229-231: EYQ → GHL
     232-867: Missing.

Show »
Length:277
Mass (Da):30,798
Checksum:i3647AE58F3E2915A
GO

Sequence cautioni

The sequence AAL36978.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence BAA76840.2 differs from that shown. Reason: Erroneous initiation.
The sequence CAB43211.2 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti172 – 1721T → M.
Corresponds to variant rs9561921 [ dbSNP | Ensembl ].
VAR_052710
Natural varianti664 – 6641M → L.
Corresponds to variant rs34303958 [ dbSNP | Ensembl ].
VAR_052711
Natural varianti736 – 7361P → S.1 Publication
Corresponds to variant rs11070136 [ dbSNP | Ensembl ].
VAR_019456

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei12 – 121M → MVRGGRPGRPRRGCRAGENR GFPGPPAPQPARPPSPPPAA LSLCPPQ in isoform 3.
VSP_010962
Alternative sequencei229 – 2313EYQ → GHL in isoform 3.
VSP_010963
Alternative sequencei232 – 867636Missing in isoform 3.
VSP_010964Add
BLAST
Alternative sequencei455 – 47420GNPLA…PAVPM → V in isoform 2.
VSP_010965Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti615 – 6151D → G in CAB43211. 1 Publication
Sequence conflicti818 – 8192KN → EK in CAB43211. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF272347 mRNA. Translation: AAL36978.1. Sequence problems.
AF272348 mRNA. Translation: AAL36979.1.
AB023213 mRNA. Translation: BAA76840.2. Different initiation.
AL139376 Genomic DNA. Translation: CAH71600.1.
AL139376 Genomic DNA. Translation: CAH71601.1.
BC041804 mRNA. Translation: AAH41804.1.
AL049931 mRNA. Translation: CAB43211.2. Different initiation.
CCDSiCCDS9477.1. [Q86YF9-2]
CCDS9478.1. [Q86YF9-1]
PIRiT08668.
RefSeqiNP_055749.1. NM_014934.4. [Q86YF9-2]
NP_945319.1. NM_198968.3. [Q86YF9-1]
UniGeneiHs.656580.
Hs.742077.

Genome annotation databases

EnsembliENST00000347108; ENSP00000257312; ENSG00000134874. [Q86YF9-1]
ENST00000361156; ENSP00000355018; ENSG00000134874. [Q86YF9-2]
ENST00000361396; ENSP00000355175; ENSG00000134874. [Q86YF9-2]
ENST00000376829; ENSP00000366025; ENSG00000134874. [Q86YF9-1]
ENST00000466569; ENSP00000431168; ENSG00000134874. [Q86YF9-3]
GeneIDi22873.
KEGGihsa:22873.
UCSCiuc001vmk.4. human. [Q86YF9-1]
uc001vml.4. human. [Q86YF9-2]

Polymorphism databases

DMDMi50400485.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF272347 mRNA. Translation: AAL36978.1 . Sequence problems.
AF272348 mRNA. Translation: AAL36979.1 .
AB023213 mRNA. Translation: BAA76840.2 . Different initiation.
AL139376 Genomic DNA. Translation: CAH71600.1 .
AL139376 Genomic DNA. Translation: CAH71601.1 .
BC041804 mRNA. Translation: AAH41804.1 .
AL049931 mRNA. Translation: CAB43211.2 . Different initiation.
CCDSi CCDS9477.1. [Q86YF9-2 ]
CCDS9478.1. [Q86YF9-1 ]
PIRi T08668.
RefSeqi NP_055749.1. NM_014934.4. [Q86YF9-2 ]
NP_945319.1. NM_198968.3. [Q86YF9-1 ]
UniGenei Hs.656580.
Hs.742077.

3D structure databases

ProteinModelPortali Q86YF9.
ModBasei Search...

Protein-protein interaction databases

BioGridi 116540. 2 interactions.
IntActi Q86YF9. 8 interactions.
STRINGi 9606.ENSP00000257312.

PTM databases

PhosphoSitei Q86YF9.

Polymorphism databases

DMDMi 50400485.

Proteomic databases

PaxDbi Q86YF9.
PRIDEi Q86YF9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000347108 ; ENSP00000257312 ; ENSG00000134874 . [Q86YF9-1 ]
ENST00000361156 ; ENSP00000355018 ; ENSG00000134874 . [Q86YF9-2 ]
ENST00000361396 ; ENSP00000355175 ; ENSG00000134874 . [Q86YF9-2 ]
ENST00000376829 ; ENSP00000366025 ; ENSG00000134874 . [Q86YF9-1 ]
ENST00000466569 ; ENSP00000431168 ; ENSG00000134874 . [Q86YF9-3 ]
GeneIDi 22873.
KEGGi hsa:22873.
UCSCi uc001vmk.4. human. [Q86YF9-1 ]
uc001vml.4. human. [Q86YF9-2 ]

Organism-specific databases

CTDi 22873.
GeneCardsi GC13M096230.
HGNCi HGNC:20908. DZIP1.
HPAi HPA054891.
HPA057272.
MIMi 608671. gene.
neXtProti NX_Q86YF9.
PharmGKBi PA134960194.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG79110.
HOVERGENi HBG059529.
InParanoidi Q86YF9.
KOi K16470.
OMAi NSALEYQ.
OrthoDBi EOG7N0C3X.
PhylomeDBi Q86YF9.
TreeFami TF330044.

Miscellaneous databases

ChiTaRSi DZIP1. human.
GeneWikii DZIP1.
GenomeRNAii 22873.
NextBioi 43419.
PROi Q86YF9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q86YF9.
Bgeei Q86YF9.
CleanExi HS_DZIP1.
Genevestigatori Q86YF9.

Family and domain databases

InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 1 hit.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 1 hit.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins."
    Moore F.L., Jaruzelska J., Fox M.S., Urano J., Firpo M.T., Turek P.J., Dorfman D.M., Reijo Pera R.A.
    Proc. Natl. Acad. Sci. U.S.A. 100:538-543(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE OF 1-776 (ISOFORM 1), INTERACTION WITH DAZ.
  2. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 615-867, VARIANT SER-736.
    Tissue: Brain.
  6. "Identification of a novel gene, DZIP (DAZ-interacting protein), that encodes a protein that interacts with DAZ (deleted in azoospermia) and is expressed in embryonic stem cells and germ cells."
    Moore F.L., Jaruzelska J., Dorfman D.M., Reijo-Pera R.A.
    Genomics 83:834-843(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, INTERACTION WITH DAZ.

Entry informationi

Entry nameiDZIP1_HUMAN
AccessioniPrimary (citable) accession number: Q86YF9
Secondary accession number(s): Q5W078
, Q5W079, Q8WY45, Q8WY46, Q9UGA5, Q9Y2K0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: June 1, 2003
Last modified: July 9, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi