Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low-density lipoprotein receptor class A domain-containing protein 3

Gene

LDLRAD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May influence APP processing, resulting in a decrease in sAPP-alpha production and increased amyloidogenic P3 peptide production.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Low-density lipoprotein receptor class A domain-containing protein 3
Gene namesi
Name:LDLRAD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:27046. LDLRAD3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 173156ExtracellularSequence analysisAdd
BLAST
Transmembranei174 – 19421HelicalSequence analysisAdd
BLAST
Topological domaini195 – 345151CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671556.

Polymorphism and mutation databases

BioMutaiLDLRAD3.
DMDMi269849675.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence analysisAdd
BLAST
Chaini18 – 345328Low-density lipoprotein receptor class A domain-containing protein 3PRO_0000299378Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi24 – 241N-linked (GlcNAc...)Sequence analysis
Disulfide bondi29 ↔ 42PROSITE-ProRule annotation
Disulfide bondi37 ↔ 55PROSITE-ProRule annotation
Disulfide bondi49 ↔ 64PROSITE-ProRule annotation
Disulfide bondi71 ↔ 84PROSITE-ProRule annotation
Disulfide bondi78 ↔ 97PROSITE-ProRule annotation
Disulfide bondi91 ↔ 106PROSITE-ProRule annotation
Disulfide bondi113 ↔ 125PROSITE-ProRule annotation
Disulfide bondi120 ↔ 138PROSITE-ProRule annotation
Disulfide bondi132 ↔ 147PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein

Proteomic databases

PaxDbiQ86YD5.
PeptideAtlasiQ86YD5.
PRIDEiQ86YD5.

Expressioni

Tissue specificityi

Expressed at high levels in brain, lung, skeletal muscle, and pancreas. Expressed at moderate levels in heart, placenta, and kidney but not detected in the liver.1 Publication

Gene expression databases

BgeeiQ86YD5.
CleanExiHS_LDLRAD3.
ExpressionAtlasiQ86YD5. baseline and differential.
GenevisibleiQ86YD5. HS.

Organism-specific databases

HPAiHPA038251.

Interactioni

Subunit structurei

Interacts with APP precursor C-terminus.By similarity

Protein-protein interaction databases

BioGridi126803. 8 interactions.
STRINGi9606.ENSP00000318607.

Structurei

3D structure databases

ProteinModelPortaliQ86YD5.
SMRiQ86YD5. Positions 35-147.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 6538LDL-receptor class A 1PROSITE-ProRule annotationAdd
BLAST
Domaini70 – 10738LDL-receptor class A 2PROSITE-ProRule annotationAdd
BLAST
Domaini112 – 14837LDL-receptor class A 3PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi274 – 2774Poly-Pro

Sequence similaritiesi

Belongs to the LDLR family.Curated
Contains 3 LDL-receptor class A domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPSZ. Eukaryota.
ENOG410XSZY. LUCA.
GeneTreeiENSGT00810000125405.
HOGENOMiHOG000060138.
HOVERGENiHBG108097.
InParanoidiQ86YD5.
OrthoDBiEOG7M98GK.
PhylomeDBiQ86YD5.
TreeFamiTF332096.

Family and domain databases

Gene3Di4.10.400.10. 3 hits.
InterProiIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view]
PfamiPF00057. Ldl_recept_a. 3 hits.
[Graphical view]
PRINTSiPR00261. LDLRECEPTOR.
SMARTiSM00192. LDLa. 3 hits.
[Graphical view]
SUPFAMiSSF57424. SSF57424. 3 hits.
PROSITEiPS01209. LDLRA_1. 3 hits.
PS50068. LDLRA_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86YD5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLLGPLCLL LSSAAESQLL PGNNFTNECN IPGNFMCSNG RCIPGAWQCD
60 70 80 90 100
GLPDCFDKSD EKECPKAKSK CGPTFFPCAS GIHCIIGRFR CNGFEDCPDG
110 120 130 140 150
SDEENCTANP LLCSTARYHC KNGLCIDKSF ICDGQNNCQD NSDEESCESS
160 170 180 190 200
QEPGSGQVFV TSENQLVYYP SITYAIIGSS VIFVLVVALL ALVLHHQRKR
210 220 230 240 250
NNLMTLPVHR LQHPVLLSRL VVLDHPHHCN VTYNVNNGIQ YVASQAEQNA
260 270 280 290 300
SEVGSPPSYS EALLDQRPAW YDLPPPPYSS DTESLNQADL PPYRSRSGSA
310 320 330 340
NSASSQAASS LLSVEDTSHS PGQPGPQEGT AEPRDSEPSQ GTEEV
Length:345
Mass (Da):37,419
Last modified:November 24, 2009 - v3
Checksum:i3EB6CADDC5EE9CC4
GO
Isoform 2 (identifier: Q86YD5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-65: ESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECP → A

Show »
Length:296
Mass (Da):32,012
Checksum:i81695D91EB937455
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti204 – 2041M → V in AAH42754 (PubMed:15489334).Curated
Sequence conflicti319 – 3191H → R in AAH42754 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei16 – 6550ESQLL…EKECP → A in isoform 2. 2 PublicationsVSP_056254Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293930 mRNA. Translation: BAH11629.1.
AK075546 mRNA. Translation: BAC11689.1.
AC026269 Genomic DNA. No translation available.
AC087277 Genomic DNA. No translation available.
AC129502 Genomic DNA. No translation available.
AL136146 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68127.1.
BC042754 mRNA. Translation: AAH42754.2.
BC136286 mRNA. Translation: AAI36287.1.
BC143824 mRNA. Translation: AAI43825.1.
CCDSiCCDS31462.1. [Q86YD5-1]
CCDS76394.1. [Q86YD5-2]
RefSeqiNP_001291192.1. NM_001304263.1. [Q86YD5-2]
NP_001291193.1. NM_001304264.1.
NP_777562.1. NM_174902.3. [Q86YD5-1]
UniGeneiHs.745134.

Genome annotation databases

EnsembliENST00000315571; ENSP00000318607; ENSG00000179241. [Q86YD5-1]
ENST00000528989; ENSP00000433954; ENSG00000179241. [Q86YD5-2]
GeneIDi143458.
KEGGihsa:143458.
UCSCiuc001mwk.2. human. [Q86YD5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293930 mRNA. Translation: BAH11629.1.
AK075546 mRNA. Translation: BAC11689.1.
AC026269 Genomic DNA. No translation available.
AC087277 Genomic DNA. No translation available.
AC129502 Genomic DNA. No translation available.
AL136146 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68127.1.
BC042754 mRNA. Translation: AAH42754.2.
BC136286 mRNA. Translation: AAI36287.1.
BC143824 mRNA. Translation: AAI43825.1.
CCDSiCCDS31462.1. [Q86YD5-1]
CCDS76394.1. [Q86YD5-2]
RefSeqiNP_001291192.1. NM_001304263.1. [Q86YD5-2]
NP_001291193.1. NM_001304264.1.
NP_777562.1. NM_174902.3. [Q86YD5-1]
UniGeneiHs.745134.

3D structure databases

ProteinModelPortaliQ86YD5.
SMRiQ86YD5. Positions 35-147.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126803. 8 interactions.
STRINGi9606.ENSP00000318607.

Polymorphism and mutation databases

BioMutaiLDLRAD3.
DMDMi269849675.

Proteomic databases

PaxDbiQ86YD5.
PeptideAtlasiQ86YD5.
PRIDEiQ86YD5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315571; ENSP00000318607; ENSG00000179241. [Q86YD5-1]
ENST00000528989; ENSP00000433954; ENSG00000179241. [Q86YD5-2]
GeneIDi143458.
KEGGihsa:143458.
UCSCiuc001mwk.2. human. [Q86YD5-1]

Organism-specific databases

CTDi143458.
GeneCardsiLDLRAD3.
H-InvDBHIX0035919.
HGNCiHGNC:27046. LDLRAD3.
HPAiHPA038251.
neXtProtiNX_Q86YD5.
PharmGKBiPA142671556.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPSZ. Eukaryota.
ENOG410XSZY. LUCA.
GeneTreeiENSGT00810000125405.
HOGENOMiHOG000060138.
HOVERGENiHBG108097.
InParanoidiQ86YD5.
OrthoDBiEOG7M98GK.
PhylomeDBiQ86YD5.
TreeFamiTF332096.

Miscellaneous databases

ChiTaRSiLDLRAD3. human.
GenomeRNAii143458.
PROiQ86YD5.

Gene expression databases

BgeeiQ86YD5.
CleanExiHS_LDLRAD3.
ExpressionAtlasiQ86YD5. baseline and differential.
GenevisibleiQ86YD5. HS.

Family and domain databases

Gene3Di4.10.400.10. 3 hits.
InterProiIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view]
PfamiPF00057. Ldl_recept_a. 3 hits.
[Graphical view]
PRINTSiPR00261. LDLRECEPTOR.
SMARTiSM00192. LDLa. 3 hits.
[Graphical view]
SUPFAMiSSF57424. SSF57424. 3 hits.
PROSITEiPS01209. LDLRA_1. 3 hits.
PS50068. LDLRA_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum.
  2. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Teratocarcinoma.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  6. "LRAD3, a novel low-density lipoprotein receptor family member that modulates amyloid precursor protein trafficking."
    Ranganathan S., Noyes N.C., Migliorini M., Winkles J.A., Battey F.D., Hyman B.T., Smith E., Yepes M., Mikhailenko I., Strickland D.K.
    J. Neurosci. 31:10836-10846(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiLRAD3_HUMAN
AccessioniPrimary (citable) accession number: Q86YD5
Secondary accession number(s): B7Z1U3, B9EG81, Q8NBJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: November 24, 2009
Last modified: July 6, 2016
This is version 100 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.