Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ZGRF1

Gene

ZGRF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ZGRF1
Alternative name(s):
GRF-type zinc finger domain-containing protein 1
Gene namesi
Name:ZGRF1
Synonyms:C4orf21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:25654. ZGRF1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei1944 – 1964HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000138658.
PharmGKBiPA144596502.

Polymorphism and mutation databases

BioMutaiC4orf21.
DMDMi550544257.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002866261 – 2104Protein ZGRF1Add BLAST2104

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei336PhosphoserineBy similarity1
Modified residuei793PhosphoserineCombined sources1
Modified residuei864PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ86YA3.
MaxQBiQ86YA3.
PaxDbiQ86YA3.
PeptideAtlasiQ86YA3.
PRIDEiQ86YA3.

PTM databases

iPTMnetiQ86YA3.
PhosphoSitePlusiQ86YA3.

Expressioni

Gene expression databases

BgeeiENSG00000138658.
CleanExiHS_C4orf21.
ExpressionAtlasiQ86YA3. baseline and differential.
GenevisibleiQ86YA3. HS.

Organism-specific databases

HPAiHPA030704.
HPA030706.

Interactioni

Protein-protein interaction databases

BioGridi120626. 4 interactors.
IntActiQ86YA3. 3 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ86YA3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IFT9. Eukaryota.
ENOG410XVJU. LUCA.
GeneTreeiENSGT00800000124068.
HOGENOMiHOG000155510.
HOVERGENiHBG103782.
InParanoidiQ86YA3.
OMAiEPEDQNE.
OrthoDBiEOG091G00H5.
PhylomeDBiQ86YA3.
TreeFamiTF335661.

Family and domain databases

Gene3Di3.40.50.300. 3 hits.
InterProiIPR018838. DUF2439.
IPR027417. P-loop_NTPase.
IPR010666. Znf_GRF.
[Graphical view]
PfamiPF10382. DUF2439. 1 hit.
PF06839. zf-GRF. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86YA3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESQEFIVLY THQKMKKSKV WQDGILKITH LGNKAILYDD KGACLESLFL
60 70 80 90 100
KCLEVKPGDD LESDRYLITV EEVKVAGAIG IVKQNVNKEA PELNSRTFIS
110 120 130 140 150
SGRSLGCQPS GLKRKFTGFQ GPRQVPKKMV IMESGESAAS HEAKKTGPTI
160 170 180 190 200
FSPFCSMPPL FPTVGKKDVN NILADPENIV TYKNRERNAM DFSSVFSPSF
210 220 230 240 250
QINPEVLCEE NYFCSPVNSG NKLSDSLLTN EPVKRDSLAS HYSGVSQNIR
260 270 280 290 300
SKAQILALLK SESSSSCEEL NSEMTEHFPQ KQPQGSLKIA TKPKYLIQQE
310 320 330 340 350
ECAEMKSTEN LYYQHQSENT MRNKSRWAMY LSSQSSPIHS STVDGNDTER
360 370 380 390 400
KPKAQEDDVN SNLKDLSLQK IIQFVETYAE ERKKYNVDQS VGNNDPSWNQ
410 420 430 440 450
EVKLEIPSFN ESSSLQVTCS SAENDGILSE SDIQEDNKIP FNQNDKGCIK
460 470 480 490 500
GSVLIKENAQ EVNTCGTLEK EYEQSESSLP ELKHLQIESS NNSRISDDIT
510 520 530 540 550
DMISESKMDN ESLNSIHESL SNVTQPFLEV TFNLNNFETS DTEEESQESN
560 570 580 590 600
KISQDSESWV KDILVNDGNS CFQKRSENTN CEEIEGEHLP FLTSVSDKPT
610 620 630 640 650
VTFPVKETLP SQFCDKTYVG FDMGICKTEN TGKEIEEYSD TLSNFESFKW
660 670 680 690 700
TDAVYGDNKE DANKPIQEVR INYDFALPPN KSKGINMNLH IPHIQNQIAE
710 720 730 740 750
NSNLFSEDAQ PQPFILGSDL DKNDEHVLPS TSSSDNSVQL LNTNQNHYEC
760 770 780 790 800
IALDKSNTHI SNSLFYPLGK KHLISKDTEA HISEPEDLGK IRSPPPDHVE
810 820 830 840 850
VETAREGKQY WNPRNSSELS GLVNTISILK SLCEHSTALD SLEILKKKNT
860 870 880 890 900
VFQQGTQQTY EPDSPPEVRK PFITVVSPKS PHLHKDSQQI LKEDEVELSE
910 920 930 940 950
PLQSVQFSSS GSKEETAFQA VIPKQIERKT CDPKPVEFQG HQVKGSATSG
960 970 980 990 1000
VMVRGHSSQL GCSQFPDSTE YENFMTETPE LPSTCMQIDF LQVTSPEENI
1010 1020 1030 1040 1050
STLSPVSTFS LNSRDEDFMV EFSETSLKAR TLPDDLHFLN LEGMKKSRSL
1060 1070 1080 1090 1100
ENENLQRLSL LSRTQVPLIT LPRTDGPPDL DSHSYMINSN TYESSGSPML
1110 1120 1130 1140 1150
NLCEKSAVLS FSIEPEDQNE TFFSEESREV NPGDVSLNNI STQSKWLKYQ
1160 1170 1180 1190 1200
NTSQCNVATP NRVDKRITDG FFAEAVSGMH FRDTSERQSD AVNESSLDSV
1210 1220 1230 1240 1250
HLQMIKGMLY QQRQDFSSQD SVSRKKVLSL NLKQTSKTEE IKNVLGGSTC
1260 1270 1280 1290 1300
YNYSVKDLQE ISGSELCFPS GQKIKSAYLP QRQIHIPAVF QSPAHYKQTF
1310 1320 1330 1340 1350
TSCLIEHLNI LLFGLAQNLQ KALSKVDISF YTSLKGEKLK NAENNVPSCH
1360 1370 1380 1390 1400
HSQPAKLVMV KKEGPNKGRL FYTCDGPKAD RCKFFKWLED VTPGYSTQEG
1410 1420 1430 1440 1450
ARPGMVLSDI KSIGLYLRSQ KIPLYEECQL LVRKGFDFQR KQYGKLKKFT
1460 1470 1480 1490 1500
TVNPEFYNEP KTKLYLKLSR KERSSAYSKN DLWVVSKTLD FELDTFIACS
1510 1520 1530 1540 1550
AFFGPSSINE IEILPLKGYF PSNWPTNMVV HALLVCNAST ELTTLKNIQD
1560 1570 1580 1590 1600
YFNPATLPLT QYLLTTSSPT IVSNKRVSKR KFIPPAFTNV STKFELLSLG
1610 1620 1630 1640 1650
ATLKLASELI QVHKLNKDQA TALIQIAQMM ASHESIEEVK ELQTHTFPIT
1660 1670 1680 1690 1700
IIHGVFGAGK SYLLAVVILF FVQLFEKSEA PTIGNARPWK LLISSSTNVA
1710 1720 1730 1740 1750
VDRVLLGLLS LGFENFIRVG SVRKIAKPIL PYSLHAGSEN ESEQLKELHA
1760 1770 1780 1790 1800
LMKEDLTPTE RVYVRKSIEQ HKLGTNRTLL KQVRVVGVTC AACPFPCMND
1810 1820 1830 1840 1850
LKFPVVVLDE CSQITEPASL LPIARFECEK LILVGDPKQL PPTIQGSDAA
1860 1870 1880 1890 1900
HENGLEQTLF DRLCLMGHKP ILLRTQYRCH PAISAIANDL FYKGALMNGV
1910 1920 1930 1940 1950
TEIERSPLLE WLPTLCFYNV KGLEQIERDN SFHNVAEATF TLKLIQSLIA
1960 1970 1980 1990 2000
SGIAGSMIGV ITLYKSQMYK LCHLLSAVDF HHPDIKTVQV STVDAFQGAE
2010 2020 2030 2040 2050
KEIIILSCVR TRQVGFIDSE KRMNVALTRG KRHLLIVGNL ACLRKNQLWG
2060 2070 2080 2090 2100
RVIQHCEGRE DGLQHANQYE PQLNHLLKDY FEKQVEEKQK KKSEKEKSKD

KSHS
Length:2,104
Mass (Da):236,602
Last modified:October 16, 2013 - v3
Checksum:iF1791F6656D4CB11
GO
Isoform 2 (identifier: Q86YA3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1865: Missing.

Show »
Length:239
Mass (Da):27,286
Checksum:iE533A8B18EB1D6E1
GO
Isoform 3 (identifier: Q86YA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     596-717: Missing.
     935-954: PVEFQGHQVKGSATSGVMVR → VKFVKNIDLFNQLHFLFCLK
     955-2104: Missing.

Show »
Length:832
Mass (Da):93,567
Checksum:iDCC038F657E50797
GO
Isoform 4 (identifier: Q86YA3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1044-1062: MKKSRSLENENLQRLSLLS → SRYHIALISVYSFKMKFFI
     1063-2104: Missing.

Show »
Length:1,062
Mass (Da):119,347
Checksum:iEA4F085FC61FEF95
GO
Isoform 5 (identifier: Q86YA3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     907-927: FSSSGSKEETAFQAVIPKQIE → TGSYSVTQTRVQWHSHSSLQP
     928-2104: Missing.

Show »
Length:927
Mass (Da):104,211
Checksum:i3B021B7A049832AC
GO
Isoform 6 (identifier: Q86YA3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MESQEFIVLYTHQKMKKSKVWQDGILKITHLGNK → MFQ
     890-947: ILKEDEVELS...FQGHQVKGSA → KTVKKKIKPT...VLSYIINNSS
     948-2104: Missing.

Show »
Length:915
Mass (Da):102,956
Checksum:i3D36B0552717982B
GO
Isoform 7 (identifier: Q86YA3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1542: Missing.
     1543-1566: TTLKNIQDYFNPATLPLTQYLLTT → MNYSTHLFQMPLFLKLFICFIFIR

Show »
Length:562
Mass (Da):63,336
Checksum:i216364CD28E78CEB
GO

Sequence cautioni

The sequence BAC86416 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti374F → L in BAG61698 (PubMed:14702039).Curated1
Sequence conflicti873I → V in BAG63860 (PubMed:14702039).Curated1
Sequence conflicti963S → G in AAH44799 (PubMed:15489334).Curated1
Sequence conflicti1251Y → M in BAG52184 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032147410N → S.Corresponds to variant rs7696816dbSNPEnsembl.1
Natural variantiVAR_032148451G → E.1 PublicationCorresponds to variant rs17854334dbSNPEnsembl.1
Natural variantiVAR_032149978T → I.Corresponds to variant rs17669218dbSNPEnsembl.1
Natural variantiVAR_0378621410I → T.Corresponds to variant rs3828539dbSNPEnsembl.1
Natural variantiVAR_0378631568S → L.Corresponds to variant rs17605622dbSNPEnsembl.1
Natural variantiVAR_0378641696S → C.Corresponds to variant rs3762891dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0532321 – 1865Missing in isoform 2. 1 PublicationAdd BLAST1865
Alternative sequenceiVSP_0532331 – 1542Missing in isoform 7. 1 PublicationAdd BLAST1542
Alternative sequenceiVSP_0532341 – 34MESQE…HLGNK → MFQ in isoform 6. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_053235596 – 717Missing in isoform 3. 1 PublicationAdd BLAST122
Alternative sequenceiVSP_053236890 – 947ILKED…VKGSA → KTVKKKIKPTLPLRIFINVS RFFCVQLKKMVRLMYINSFI SFPLNIVVLSYIINNSS in isoform 6. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_053237907 – 927FSSSG…PKQIE → TGSYSVTQTRVQWHSHSSLQ P in isoform 5. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_053238928 – 2104Missing in isoform 5. 1 PublicationAdd BLAST1177
Alternative sequenceiVSP_053239935 – 954PVEFQ…GVMVR → VKFVKNIDLFNQLHFLFCLK in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_053240948 – 2104Missing in isoform 6. 1 PublicationAdd BLAST1157
Alternative sequenceiVSP_053241955 – 2104Missing in isoform 3. 1 PublicationAdd BLAST1150
Alternative sequenceiVSP_0532421044 – 1062MKKSR…LSLLS → SRYHIALISVYSFKMKFFI in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0532431063 – 2104Missing in isoform 4. 1 PublicationAdd BLAST1042
Alternative sequenceiVSP_0532441543 – 1566TTLKN…YLLTT → MNYSTHLFQMPLFLKLFICF IFIR in isoform 7. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002193 mRNA. Translation: BAA92130.1.
AK090556 mRNA. Translation: BAG52184.1.
AK126054 mRNA. Translation: BAC86416.1. Different initiation.
AK299831 mRNA. Translation: BAG61698.1.
AK302613 mRNA. Translation: BAG63860.1.
AC023886 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06281.1.
AL137700 mRNA. Translation: CAB70881.1.
BC044799 mRNA. Translation: AAH44799.1.
CCDSiCCDS3700.2. [Q86YA3-1]
PIRiT46441.
RefSeqiNP_060862.3. NM_018392.4. [Q86YA3-1]
XP_005263172.1. XM_005263115.3. [Q86YA3-1]
UniGeneiHs.380346.
Hs.713663.

Genome annotation databases

EnsembliENST00000309071; ENSP00000309095; ENSG00000138658. [Q86YA3-4]
ENST00000445203; ENSP00000390505; ENSG00000138658. [Q86YA3-1]
ENST00000505019; ENSP00000424737; ENSG00000138658. [Q86YA3-1]
ENST00000612287; ENSP00000482897; ENSG00000138658. [Q86YA3-2]
GeneIDi55345.
KEGGihsa:55345.
UCSCiuc003iau.4. human. [Q86YA3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002193 mRNA. Translation: BAA92130.1.
AK090556 mRNA. Translation: BAG52184.1.
AK126054 mRNA. Translation: BAC86416.1. Different initiation.
AK299831 mRNA. Translation: BAG61698.1.
AK302613 mRNA. Translation: BAG63860.1.
AC023886 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06281.1.
AL137700 mRNA. Translation: CAB70881.1.
BC044799 mRNA. Translation: AAH44799.1.
CCDSiCCDS3700.2. [Q86YA3-1]
PIRiT46441.
RefSeqiNP_060862.3. NM_018392.4. [Q86YA3-1]
XP_005263172.1. XM_005263115.3. [Q86YA3-1]
UniGeneiHs.380346.
Hs.713663.

3D structure databases

ProteinModelPortaliQ86YA3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120626. 4 interactors.
IntActiQ86YA3. 3 interactors.

PTM databases

iPTMnetiQ86YA3.
PhosphoSitePlusiQ86YA3.

Polymorphism and mutation databases

BioMutaiC4orf21.
DMDMi550544257.

Proteomic databases

EPDiQ86YA3.
MaxQBiQ86YA3.
PaxDbiQ86YA3.
PeptideAtlasiQ86YA3.
PRIDEiQ86YA3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309071; ENSP00000309095; ENSG00000138658. [Q86YA3-4]
ENST00000445203; ENSP00000390505; ENSG00000138658. [Q86YA3-1]
ENST00000505019; ENSP00000424737; ENSG00000138658. [Q86YA3-1]
ENST00000612287; ENSP00000482897; ENSG00000138658. [Q86YA3-2]
GeneIDi55345.
KEGGihsa:55345.
UCSCiuc003iau.4. human. [Q86YA3-1]

Organism-specific databases

CTDi55345.
GeneCardsiZGRF1.
HGNCiHGNC:25654. ZGRF1.
HPAiHPA030704.
HPA030706.
neXtProtiNX_Q86YA3.
OpenTargetsiENSG00000138658.
PharmGKBiPA144596502.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFT9. Eukaryota.
ENOG410XVJU. LUCA.
GeneTreeiENSGT00800000124068.
HOGENOMiHOG000155510.
HOVERGENiHBG103782.
InParanoidiQ86YA3.
OMAiEPEDQNE.
OrthoDBiEOG091G00H5.
PhylomeDBiQ86YA3.
TreeFamiTF335661.

Miscellaneous databases

GenomeRNAii55345.
PROiQ86YA3.

Gene expression databases

BgeeiENSG00000138658.
CleanExiHS_C4orf21.
ExpressionAtlasiQ86YA3. baseline and differential.
GenevisibleiQ86YA3. HS.

Family and domain databases

Gene3Di3.40.50.300. 3 hits.
InterProiIPR018838. DUF2439.
IPR027417. P-loop_NTPase.
IPR010666. Znf_GRF.
[Graphical view]
PfamiPF10382. DUF2439. 1 hit.
PF06839. zf-GRF. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiZGRF1_HUMAN
AccessioniPrimary (citable) accession number: Q86YA3
Secondary accession number(s): B3KQX2
, B4DSN6, B4DYU8, E9PDE1, G5EA02, Q6ZU11, Q9NSW3, Q9NUJ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: October 16, 2013
Last modified: November 2, 2016
This is version 93 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.