Q86Y56 (HEAT2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: HEAT repeat-containing protein 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 855 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Cytoplasm. Note: Observed only in the cytoplasm of ciliated airway epithelial cells. Absent from cilia. Ref.7 |
| Involvement in disease | Primary ciliary dyskinesia 18 (CILD18) [MIM:614874]: A disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. |
| Sequence similarities | Contains 10 HEAT repeats. |
| Sequence caution | The sequence AAH10850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Ciliopathy Disease mutation Primary ciliary dyskinesia |
| Domain | Repeat |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86Y56-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86Y56-2) The sequence of this isoform differs from the canonical sequence as follows: 811-855: EVLKEGSGLF...QHVQAVPATQ → DVPGSPSPSAMIGSFLRPPHPWRTVSQLNLFSS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86Y56-3) The sequence of this isoform differs from the canonical sequence as follows: 1-620: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 855 | 855 | HEAT repeat-containing protein 2 | PRO_0000050820 | |||||
Regions | |||||||||
| Repeat | 71 – 109 | 39 | HEAT 1 | ||||||
| Repeat | 202 – 240 | 39 | HEAT 2 | ||||||
| Repeat | 241 – 278 | 38 | HEAT 3 | ||||||
| Repeat | 280 – 318 | 39 | HEAT 4 | ||||||
| Repeat | 354 – 376 | 23 | HEAT 5 | ||||||
| Repeat | 377 – 414 | 38 | HEAT 6 | ||||||
| Repeat | 599 – 638 | 40 | HEAT 7 | ||||||
| Repeat | 696 – 734 | 39 | HEAT 8 | ||||||
| Repeat | 738 – 776 | 39 | HEAT 9 | ||||||
| Repeat | 784 – 822 | 39 | HEAT 10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 620 | 620 | Missing in isoform 3. | VSP_016109 | |||||
| Alternative sequence | 811 – 855 | 45 | EVLKE…VPATQ → DVPGSPSPSAMIGSFLRPPH PWRTVSQLNLFSS in isoform 2. | VSP_016110 | |||||
| Natural variant | 560 | 1 | R → C. Corresponds to variant rs73258248 [ dbSNP | Ensembl ]. | VAR_060463 | |||||
| Natural variant | 632 | 1 | V → A. Corresponds to variant rs4720951 [ dbSNP | Ensembl ]. | VAR_056911 | |||||
| Natural variant | 743 | 1 | R → K. Ref.1 Ref.3 Ref.5 Corresponds to variant rs3922641 [ dbSNP | Ensembl ]. | VAR_060464 | |||||
| Natural variant | 795 | 1 | L → P in CILD18. Ref.7 | VAR_068969 | |||||
Experimental info | |||||||||
| Sequence conflict | 128 | 1 | P → H in AAH47240. Ref.3 | ||||||
| Sequence conflict | 419 – 421 | 3 | SCT → TSS in AAH10850. Ref.3 | ||||||
| Sequence conflict | 454 | 1 | L → M in AAH47240. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK000404 mRNA. Translation: BAA91142.1. AC144411 Genomic DNA. No translation available. BC010850 mRNA. Translation: AAH10850.1. Different initiation. BC047240 mRNA. Translation: AAH47240.1. AL832914 mRNA. Translation: CAH10624.2. |
| IPI | IPI00242630. IPI00654611. IPI00784196. |
| RefSeq | NP_060272.3. NM_017802.3. |
| UniGene | Hs.535896. |
3D structure databases | |
| ProteinModelPortal | Q86Y56. |
| SMR | Q86Y56. Positions 166-235, 745-770. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86Y56. 2 interactions. |
| MINT | MINT-1391398. |
| STRING | 9606.ENSP00000297440. |
PTM databases | |
| PhosphoSite | Q86Y56. |
Polymorphism databases | |
| DMDM | 269849689. |
Proteomic databases | |
| PaxDb | Q86Y56. |
| PRIDE | Q86Y56. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000297440; ENSP00000297440; ENSG00000164818. ENST00000313147; ENSP00000321451; ENSG00000164818. |
| GeneID | 54919. |
| KEGG | hsa:54919. |
| UCSC | uc003siz.2. human. uc003sjb.2. human. |
Organism-specific databases | |
| CTD | 54919. |
| GeneCards | GC07P000732. |
| H-InvDB | HIX0006405. HIX0200638. |
| HGNC | HGNC:26013. HEATR2. |
| HPA | HPA020243. |
| MIM | 614864. gene. 614874. phenotype. |
| neXtProt | NX_Q86Y56. |
| PharmGKB | PA145008229. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG29211. |
| HOGENOM | HOG000007194. |
| HOVERGEN | HBG079488. |
| InParanoid | Q86Y56. |
| OMA | PELLQFS. |
| OrthoDB | EOG4XD3QM. |
Gene expression databases | |
| ArrayExpress | Q86Y56. |
| Bgee | Q86Y56. |
| CleanEx | HS_HEATR2. |
| Genevestigator | Q86Y56. |
| GermOnline | ENSG00000164818. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 3 hits. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR000357. HEAT. IPR021133. HEAT_type_2. [Graphical view] |
| Pfam | PF02985. HEAT. 2 hits. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS50077. HEAT_REPEAT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | HEATR2. human. |
| GenomeRNAi | 54919. |
| NextBio | 57986. |
| SOURCE | Search... |
Entry information
| Entry name | HEAT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86Y56 Secondary accession number(s): Q69YL1, Q96FI9, Q9NX75 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
