Q86Y56 (HEAT2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: HEAT repeat-containing protein 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 855 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 10 HEAT repeats. |
| Sequence caution | The sequence AAH10850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| PTM | Acetylation |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86Y56-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86Y56-2) The sequence of this isoform differs from the canonical sequence as follows: 811-855: EVLKEGSGLF...QHVQAVPATQ → DVPGSPSPSAMIGSFLRPPHPWRTVSQLNLFSS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86Y56-3) The sequence of this isoform differs from the canonical sequence as follows: 1-620: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 855 | 854 | HEAT repeat-containing protein 2 | PRO_0000050820 | |||||
Regions | |||||||||
| Repeat | 71 – 109 | 39 | HEAT 1 | ||||||
| Repeat | 202 – 240 | 39 | HEAT 2 | ||||||
| Repeat | 241 – 278 | 38 | HEAT 3 | ||||||
| Repeat | 280 – 318 | 39 | HEAT 4 | ||||||
| Repeat | 354 – 376 | 23 | HEAT 5 | ||||||
| Repeat | 377 – 414 | 38 | HEAT 6 | ||||||
| Repeat | 599 – 638 | 40 | HEAT 7 | ||||||
| Repeat | 696 – 734 | 39 | HEAT 8 | ||||||
| Repeat | 738 – 776 | 39 | HEAT 9 | ||||||
| Repeat | 784 – 822 | 39 | HEAT 10 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 620 | 620 | Missing in isoform 3. | VSP_016109 | |||||
| Alternative sequence | 811 – 855 | 45 | EVLKE…VPATQ → DVPGSPSPSAMIGSFLRPPH PWRTVSQLNLFSS in isoform 2. | VSP_016110 | |||||
| Natural variant | 560 | 1 | R → C. Corresponds to variant rs73258248 [ dbSNP | Ensembl ]. | VAR_060463 | |||||
| Natural variant | 632 | 1 | V → A. Corresponds to variant rs4720951 [ dbSNP | Ensembl ]. | VAR_056911 | |||||
| Natural variant | 743 | 1 | R → K. Ref.1 Ref.3 Ref.5 Corresponds to variant rs3922641 [ dbSNP | Ensembl ]. | VAR_060464 | |||||
Experimental info | |||||||||
| Sequence conflict | 128 | 1 | P → H in AAH47240. Ref.3 | ||||||
| Sequence conflict | 419 – 421 | 3 | SCT → TSS in AAH10850. Ref.3 | ||||||
| Sequence conflict | 454 | 1 | L → M in AAH47240. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT LYS-743. Tissue: Colon carcinoma. |
| [2] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 422-855 (ISOFORM 2), VARIANT LYS-743. Tissue: Hippocampus and Pancreas. |
| [4] | Bienvenut W.V. Submitted (JUN-2005) to UniProtKB Cited for: PROTEIN SEQUENCE OF 94-105; 423-438; 625-655 AND 804-814, MASS SPECTROMETRY. Tissue: B-cell lymphoma. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 662-855 (ISOFORMS 1/3), VARIANT LYS-743. Tissue: Melanoma. |
| [6] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK000404 mRNA. Translation: BAA91142.1. AC144411 Genomic DNA. No translation available. BC010850 mRNA. Translation: AAH10850.1. Different initiation. BC047240 mRNA. Translation: AAH47240.1. AL832914 mRNA. Translation: CAH10624.2. |
| IPI | IPI00242630. IPI00654611. IPI00784196. |
| RefSeq | NP_060272.3. NM_017802.3. |
| UniGene | Hs.535896. |
3D structure databases | |
| ProteinModelPortal | Q86Y56. |
| SMR | Q86Y56. Positions 76-101, 658-687. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86Y56. 2 interactions. |
| MINT | MINT-1391398. |
PTM databases | |
| PhosphoSite | Q86Y56. |
Polymorphism databases | |
| DMDM | 269849689. |
Proteomic databases | |
| PRIDE | Q86Y56. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000297440; ENSP00000297440; ENSG00000164818. |
| GeneID | 54919. |
| KEGG | hsa:54919. |
| UCSC | uc003sjb.2. human. uc010krz.1. human. |
Organism-specific databases | |
| CTD | 54919. |
| GeneCards | GC07P000732. |
| H-InvDB | HIX0006405. |
| HGNC | HGNC:26013. HEATR2. |
| HPA | HPA020243. |
| neXtProt | NX_Q86Y56. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG12345. |
| GeneTree | ENSGT00390000005666. |
| HOGENOM | HBG356298. |
| HOVERGEN | HBG079488. |
| InParanoid | Q86Y56. |
| OMA | GAVIQFG. |
| OrthoDB | EOG4XD3QM. |
| PhylomeDB | Q86Y56. |
Gene expression databases | |
| ArrayExpress | Q86Y56. |
| Bgee | Q86Y56. |
| CleanEx | HS_HEATR2. |
| Genevestigator | Q86Y56. |
| GermOnline | ENSG00000164818. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR000357. HEAT. IPR021133. HEAT_type_2. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 2 hits. |
| Pfam | PF02985. HEAT. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS50077. HEAT_REPEAT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 57986. |
Entry information
| Entry name | HEAT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86Y56 Secondary accession number(s): Q69YL1, Q96FI9, Q9NX75 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with