Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

V-set and immunoglobulin domain-containing protein 1

Gene

VSIG1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
V-set and immunoglobulin domain-containing protein 1
Alternative name(s):
Cell surface A33 antigen
Glycoprotein A34
Gene namesi
Name:VSIG1
Synonyms:GPA34
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28675. VSIG1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 232ExtracellularSequence analysisAdd BLAST211
Transmembranei233 – 253HelicalSequence analysisAdd BLAST21
Topological domaini254 – 387CytoplasmicSequence analysisAdd BLAST134

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi340547.
OpenTargetsiENSG00000101842.
PharmGKBiPA134944198.

Polymorphism and mutation databases

BioMutaiVSIG1.
DMDMi74759503.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000031357322 – 387V-set and immunoglobulin domain-containing protein 1Add BLAST366

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi32N-linked (GlcNAc...)Sequence analysis1
Glycosylationi38N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi43 ↔ 116PROSITE-ProRule annotation
Glycosylationi133N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi161 ↔ 211PROSITE-ProRule annotation
Glycosylationi200N-linked (GlcNAc...)Sequence analysis1
Glycosylationi219N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

Highly N-glycosylated. Appears not to contain significant amounts of O-linked carbohydrates or sialic acid in its sugar moieties.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlasiQ86XK7.
PRIDEiQ86XK7.

PTM databases

PhosphoSitePlusiQ86XK7.

Expressioni

Tissue specificityi

Detected only in stomach mucosa and testis, and to a much lesser level in pancreas (at protein level). Detected in gastric cancers (31%), esophageal carcinomas (50%) and ovarian cancers (23%).1 Publication

Gene expression databases

BgeeiENSG00000101842.
CleanExiHS_VSIG1.
ExpressionAtlasiQ86XK7. baseline and differential.
GenevisibleiQ86XK7. HS.

Organism-specific databases

HPAiHPA001445.
HPA036310.
HPA036311.

Interactioni

Protein-protein interaction databases

BioGridi131072. 54 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ86XK7.
SMRiQ86XK7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 132Ig-like V-typeAdd BLAST111
Domaini140 – 227Ig-like C2-typeAdd BLAST88

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000119145.
HOGENOMiHOG000154830.
HOVERGENiHBG106684.
InParanoidiQ86XK7.
OMAiVCFARNK.
OrthoDBiEOG091G05PI.
PhylomeDBiQ86XK7.
TreeFamiTF318234.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR000920. Myelin_P0-rel.
IPR029861. VSIG1.
[Graphical view]
PANTHERiPTHR12231:SF115. PTHR12231:SF115. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR00213. MYELINP0.
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86XK7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVFAFWKVFL ILSCLAGQVS VVQVTIPDGF VNVTVGSNVT LICIYTTTVA
60 70 80 90 100
SREQLSIQWS FFHKKEMEPI SIYFSQGGQA VAIGQFKDRI TGSNDPGNAS
110 120 130 140 150
ITISHMQPAD SGIYICDVNN PPDFLGQNQG ILNVSVLVKP SKPLCSVQGR
160 170 180 190 200
PETGHTISLS CLSALGTPSP VYYWHKLEGR DIVPVKENFN PTTGILVIGN
210 220 230 240 250
LTNFEQGYYQ CTAINRLGNS SCEIDLTSSH PEVGIIVGAL IGSLVGAAII
260 270 280 290 300
ISVVCFARNK AKAKAKERNS KTIAELEPMT KINPRGESEA MPREDATQLE
310 320 330 340 350
VTLPSSIHET GPDTIQEPDY EPKPTQEPAP EPAPGSEPMA VPDLDIELEL
360 370 380
EPETQSELEP EPEPEPESEP GVVVEPLSED EKGVVKA
Length:387
Mass (Da):41,811
Last modified:June 1, 2003 - v1
Checksum:iF5D39F3B21FF1D0D
GO
Isoform 2 (identifier: Q86XK7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-71: S → SHSSCLSTEGMEEKAVSQCLKMTHARDARGRCSWTSE

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):45,807
Checksum:i72E695E78E2A7EB7
GO

Sequence cautioni

The sequence CAE45954 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049955147V → I.Corresponds to variant rs17254305dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04547571S → SHSSCLSTEGMEEKAVSQCL KMTHARDARGRCSWTSE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301311 mRNA. No translation available.
BX640913 mRNA. Translation: CAE45954.1. Different initiation.
BX648658 mRNA. Translation: CAH56142.1.
AL031177 Genomic DNA. No translation available.
AL953860 Genomic DNA. No translation available.
BC043216 mRNA. Translation: AAH43216.1.
BK005767 mRNA. Translation: DAA05750.1.
CCDSiCCDS14535.1. [Q86XK7-1]
CCDS55474.1. [Q86XK7-2]
RefSeqiNP_001164024.1. NM_001170553.1. [Q86XK7-2]
NP_872413.1. NM_182607.4. [Q86XK7-1]
UniGeneiHs.177164.

Genome annotation databases

EnsembliENST00000217957; ENSP00000217957; ENSG00000101842. [Q86XK7-1]
ENST00000415430; ENSP00000402219; ENSG00000101842. [Q86XK7-2]
GeneIDi340547.
KEGGihsa:340547.
UCSCiuc004eno.4. human. [Q86XK7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301311 mRNA. No translation available.
BX640913 mRNA. Translation: CAE45954.1. Different initiation.
BX648658 mRNA. Translation: CAH56142.1.
AL031177 Genomic DNA. No translation available.
AL953860 Genomic DNA. No translation available.
BC043216 mRNA. Translation: AAH43216.1.
BK005767 mRNA. Translation: DAA05750.1.
CCDSiCCDS14535.1. [Q86XK7-1]
CCDS55474.1. [Q86XK7-2]
RefSeqiNP_001164024.1. NM_001170553.1. [Q86XK7-2]
NP_872413.1. NM_182607.4. [Q86XK7-1]
UniGeneiHs.177164.

3D structure databases

ProteinModelPortaliQ86XK7.
SMRiQ86XK7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131072. 54 interactors.

PTM databases

PhosphoSitePlusiQ86XK7.

Polymorphism and mutation databases

BioMutaiVSIG1.
DMDMi74759503.

Proteomic databases

PeptideAtlasiQ86XK7.
PRIDEiQ86XK7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000217957; ENSP00000217957; ENSG00000101842. [Q86XK7-1]
ENST00000415430; ENSP00000402219; ENSG00000101842. [Q86XK7-2]
GeneIDi340547.
KEGGihsa:340547.
UCSCiuc004eno.4. human. [Q86XK7-1]

Organism-specific databases

CTDi340547.
DisGeNETi340547.
GeneCardsiVSIG1.
HGNCiHGNC:28675. VSIG1.
HPAiHPA001445.
HPA036310.
HPA036311.
MIMi300620. gene.
neXtProtiNX_Q86XK7.
OpenTargetsiENSG00000101842.
PharmGKBiPA134944198.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119145.
HOGENOMiHOG000154830.
HOVERGENiHBG106684.
InParanoidiQ86XK7.
OMAiVCFARNK.
OrthoDBiEOG091G05PI.
PhylomeDBiQ86XK7.
TreeFamiTF318234.

Miscellaneous databases

ChiTaRSiVSIG1. human.
GenomeRNAii340547.
PROiQ86XK7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101842.
CleanExiHS_VSIG1.
ExpressionAtlasiQ86XK7. baseline and differential.
GenevisibleiQ86XK7. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR000920. Myelin_P0-rel.
IPR029861. VSIG1.
[Graphical view]
PANTHERiPTHR12231:SF115. PTHR12231:SF115. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR00213. MYELINP0.
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVSIG1_HUMAN
AccessioniPrimary (citable) accession number: Q86XK7
Secondary accession number(s): C9J4P2, Q6MZS4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2003
Last modified: November 2, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.