Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Swi5-dependent recombination DNA repair protein 1 homolog

Gene

SFR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination (PubMed:21252223). Acts as a transcriptional modulator for ESR1 (PubMed:23874500).2 Publications

GO - Molecular functioni

  • ligand-dependent nuclear receptor transcription coactivator activity Source: UniProtKB

GO - Biological processi

  • cellular response to estrogen stimulus Source: UniProtKB
  • double-strand break repair via homologous recombination Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Biological processDNA damage, DNA repair, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Swi5-dependent recombination DNA repair protein 1 homolog
Alternative name(s):
Meiosis protein 5 homolog
Gene namesi
Name:SFR1
Synonyms:C10orf78, MEI5, MEIR5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000156384.14
HGNCiHGNC:29574 SFR1
MIMi616527 gene
neXtProtiNX_Q86XK3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi119392
OpenTargetsiENSG00000156384
PharmGKBiPA134989928

Polymorphism and mutation databases

BioMutaiSFR1
DMDMi311033362

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000898051 – 245Swi5-dependent recombination DNA repair protein 1 homologAdd BLAST245

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei61PhosphoserineCombined sources1
Modified residuei64PhosphoserineBy similarity1
Isoform 3 (identifier: Q86XK3-3)
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ86XK3
PaxDbiQ86XK3
PeptideAtlasiQ86XK3
PRIDEiQ86XK3

PTM databases

iPTMnetiQ86XK3
PhosphoSitePlusiQ86XK3

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000156384
CleanExiHS_C10orf78
GenevisibleiQ86XK3 HS

Organism-specific databases

HPAiHPA039617

Interactioni

Subunit structurei

Component of the SWI5-SFR1 complex. Interacts with RAD51; the interaction is weak (PubMed:21252223). Interacts with ESR1 in the ligand-independent and ligand-dependent manner (PubMed:23874500).2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi125639, 15 interactors
IntActiQ86XK3, 9 interactors
STRINGi9606.ENSP00000358742

Structurei

3D structure databases

ProteinModelPortaliQ86XK3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili149 – 177Sequence analysisAdd BLAST29

Sequence similaritiesi

Belongs to the SFR1/MEI5 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IF5Y Eukaryota
ENOG411284F LUCA
GeneTreeiENSGT00390000018550
HOGENOMiHOG000060220
HOVERGENiHBG056268
InParanoidiQ86XK3
OMAiIKKWRSC
OrthoDBiEOG091G0I3L
PhylomeDBiQ86XK3
TreeFamiTF332725

Family and domain databases

InterProiView protein in InterPro
IPR018468 Ds-recomb_repair_prot_Mei5
PfamiView protein in Pfam
PF10376 Mei5, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86XK3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEGEKNQDF TFKMESPSDS AVVLPSTPQA SANPSSPYTN SSRKQPMSAT
60 70 80 90 100
LRERLRKTRF SFNSSYNVVK RLKVESEEND QTFSEKPASS TEENCLEFQE
110 120 130 140 150
SFKHIDSEFE ENTNLKNTLK NLNVCESQSL DSGSCSALQN EFVSEKLPKQ
160 170 180 190 200
RLNAEKAKLV KQVQEKEDLL RRLKLVKMYR SKNDLSQLQL LIKKWRSCSQ
210 220 230 240
LLLYELQSAV SEENKKLSLT QLIDHYGLDD KLLHYNRSEE EFIDV
Note: Gene prediction based on EST data.
Length:245
Mass (Da):28,262
Last modified:November 2, 2010 - v2
Checksum:i65CCD48BAD5C45AD
GO
Isoform 2 (identifier: Q86XK3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MAEG → MKNLVVPMWEGKWKTAKRARMNYKVKLEEISGLLVDALYTNTIYYLIKVDYREVWLIRLFYNFSFL

Show »
Length:307
Mass (Da):35,939
Checksum:i58CEEF780DAA8BC5
GO
Isoform 3 (identifier: Q86XK3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.

Show »
Length:232
Mass (Da):26,735
Checksum:iCC609AC6A6CCFE50
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02309819D → G1 PublicationCorresponds to variant dbSNP:rs10786783Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0400371 – 13Missing in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0400381 – 4MAEG → MKNLVVPMWEGKWKTAKRAR MNYKVKLEEISGLLVDALYT NTIYYLIKVDYREVWLIRLF YNFSFL in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291184 mRNA Translation: BAF83873.1
AL357336 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49610.1
CH471066 Genomic DNA Translation: EAW49611.1
BC020892 mRNA Translation: AAH20892.2
BC140835 mRNA Translation: AAI40836.1
CCDSiCCDS31279.1 [Q86XK3-1]
CCDS31280.1 [Q86XK3-3]
RefSeqiNP_001002759.1, NM_001002759.1 [Q86XK3-1]
NP_660290.3, NM_145247.4 [Q86XK3-3]
XP_005269578.1, XM_005269521.3 [Q86XK3-2]
XP_016871161.1, XM_017015672.1 [Q86XK3-3]
UniGeneiHs.93667

Genome annotation databases

EnsembliENST00000369727; ENSP00000358742; ENSG00000156384 [Q86XK3-1]
ENST00000369729; ENSP00000358744; ENSG00000156384 [Q86XK3-3]
GeneIDi119392
KEGGihsa:119392
UCSCiuc001kxs.3 human [Q86XK3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSFR1_HUMAN
AccessioniPrimary (citable) accession number: Q86XK3
Secondary accession number(s): A8K569
, B2RTV8, Q5JT39, Q5JT40, Q8WW47
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: November 2, 2010
Last modified: February 28, 2018
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health