Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Swi5-dependent recombination DNA repair protein 1 homolog

Gene

SFR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination (PubMed:21252223). Acts as a transcriptional modulator for ESR1 (PubMed:23874500).2 Publications

GO - Molecular functioni

  • ligand-dependent nuclear receptor transcription coactivator activity Source: UniProtKB

GO - Biological processi

  • cellular response to estrogen stimulus Source: UniProtKB
  • double-strand break repair via homologous recombination Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA repair, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Swi5-dependent recombination DNA repair protein 1 homolog
Alternative name(s):
Meiosis protein 5 homolog
Gene namesi
Name:SFR1
Synonyms:C10orf78, MEI5, MEIR5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:29574. SFR1.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
  • Swi5-Sfr1 complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134989928.

Polymorphism and mutation databases

BioMutaiSFR1.
DMDMi311033362.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 245245Swi5-dependent recombination DNA repair protein 1 homologPRO_0000089805Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei61 – 611PhosphoserineCombined sources
Modified residuei64 – 641PhosphoserineBy similarity
Isoform 3 (identifier: Q86XK3-3)
Modified residuei1 – 11N-acetylmethionineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ86XK3.
PaxDbiQ86XK3.
PeptideAtlasiQ86XK3.
PRIDEiQ86XK3.

PTM databases

iPTMnetiQ86XK3.
PhosphoSiteiQ86XK3.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000156384.
CleanExiHS_C10orf78.
GenevisibleiQ86XK3. HS.

Organism-specific databases

HPAiHPA039617.

Interactioni

Subunit structurei

Component of the SWI5-SFR1 complex. Interacts with RAD51; the interaction is weak (PubMed:21252223). Interacts with ESR1 in the ligand-independent and ligand-dependent manner (PubMed:23874500).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CEP70Q8NHQ13EBI-1104535,EBI-739624
HMBOX1Q6NT76-23EBI-1104535,EBI-10212206
MRFAP1L1Q96HT83EBI-1104535,EBI-748896
NDC80O147773EBI-1104535,EBI-715849
NMIQ132873EBI-1104535,EBI-372942
NMIQ8WTW23EBI-1104535,EBI-10174268
RINT1Q6NUQ13EBI-1104535,EBI-726876
RNF40O751503EBI-1104535,EBI-744408
TFIP11Q9UBB93EBI-1104535,EBI-1105213

Protein-protein interaction databases

BioGridi125639. 15 interactions.
IntActiQ86XK3. 10 interactions.
STRINGi9606.ENSP00000358742.

Structurei

3D structure databases

ProteinModelPortaliQ86XK3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili149 – 17729Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the SFR1/MEI5 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IF5Y. Eukaryota.
ENOG411284F. LUCA.
GeneTreeiENSGT00390000018550.
HOGENOMiHOG000060220.
HOVERGENiHBG056268.
InParanoidiQ86XK3.
OMAiIKKWRSC.
OrthoDBiEOG091G0I3L.
PhylomeDBiQ86XK3.
TreeFamiTF332725.

Family and domain databases

InterProiIPR018468. Ds-recomb_repair_prot_Mei5.
[Graphical view]
PfamiPF10376. Mei5. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86XK3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEGEKNQDF TFKMESPSDS AVVLPSTPQA SANPSSPYTN SSRKQPMSAT
60 70 80 90 100
LRERLRKTRF SFNSSYNVVK RLKVESEEND QTFSEKPASS TEENCLEFQE
110 120 130 140 150
SFKHIDSEFE ENTNLKNTLK NLNVCESQSL DSGSCSALQN EFVSEKLPKQ
160 170 180 190 200
RLNAEKAKLV KQVQEKEDLL RRLKLVKMYR SKNDLSQLQL LIKKWRSCSQ
210 220 230 240
LLLYELQSAV SEENKKLSLT QLIDHYGLDD KLLHYNRSEE EFIDV
Note: Gene prediction based on EST data.
Length:245
Mass (Da):28,262
Last modified:November 2, 2010 - v2
Checksum:i65CCD48BAD5C45AD
GO
Isoform 2 (identifier: Q86XK3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MAEG → MKNLVVPMWEGKWKTAKRARMNYKVKLEEISGLLVDALYTNTIYYLIKVDYREVWLIRLFYNFSFL

Show »
Length:307
Mass (Da):35,939
Checksum:i58CEEF780DAA8BC5
GO
Isoform 3 (identifier: Q86XK3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.

Show »
Length:232
Mass (Da):26,735
Checksum:iCC609AC6A6CCFE50
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti19 – 191D → G.1 Publication
Corresponds to variant rs10786783 [ dbSNP | Ensembl ].
VAR_023098

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1313Missing in isoform 3. 1 PublicationVSP_040037Add
BLAST
Alternative sequencei1 – 44MAEG → MKNLVVPMWEGKWKTAKRAR MNYKVKLEEISGLLVDALYT NTIYYLIKVDYREVWLIRLF YNFSFL in isoform 2. 1 PublicationVSP_040038

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291184 mRNA. Translation: BAF83873.1.
AL357336 Genomic DNA. Translation: CAI40454.1.
AL357336 Genomic DNA. Translation: CAI40456.1.
CH471066 Genomic DNA. Translation: EAW49610.1.
CH471066 Genomic DNA. Translation: EAW49611.1.
BC020892 mRNA. Translation: AAH20892.2.
BC140835 mRNA. Translation: AAI40836.1.
CCDSiCCDS31279.1. [Q86XK3-1]
CCDS31280.1. [Q86XK3-3]
RefSeqiNP_001002759.1. NM_001002759.1. [Q86XK3-1]
NP_660290.3. NM_145247.4. [Q86XK3-3]
XP_005269578.1. XM_005269521.3. [Q86XK3-2]
UniGeneiHs.93667.

Genome annotation databases

EnsembliENST00000369727; ENSP00000358742; ENSG00000156384. [Q86XK3-1]
ENST00000369729; ENSP00000358744; ENSG00000156384. [Q86XK3-3]
GeneIDi119392.
KEGGihsa:119392.
UCSCiuc001kxs.3. human. [Q86XK3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291184 mRNA. Translation: BAF83873.1.
AL357336 Genomic DNA. Translation: CAI40454.1.
AL357336 Genomic DNA. Translation: CAI40456.1.
CH471066 Genomic DNA. Translation: EAW49610.1.
CH471066 Genomic DNA. Translation: EAW49611.1.
BC020892 mRNA. Translation: AAH20892.2.
BC140835 mRNA. Translation: AAI40836.1.
CCDSiCCDS31279.1. [Q86XK3-1]
CCDS31280.1. [Q86XK3-3]
RefSeqiNP_001002759.1. NM_001002759.1. [Q86XK3-1]
NP_660290.3. NM_145247.4. [Q86XK3-3]
XP_005269578.1. XM_005269521.3. [Q86XK3-2]
UniGeneiHs.93667.

3D structure databases

ProteinModelPortaliQ86XK3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125639. 15 interactions.
IntActiQ86XK3. 10 interactions.
STRINGi9606.ENSP00000358742.

PTM databases

iPTMnetiQ86XK3.
PhosphoSiteiQ86XK3.

Polymorphism and mutation databases

BioMutaiSFR1.
DMDMi311033362.

Proteomic databases

MaxQBiQ86XK3.
PaxDbiQ86XK3.
PeptideAtlasiQ86XK3.
PRIDEiQ86XK3.

Protocols and materials databases

DNASUi119392.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369727; ENSP00000358742; ENSG00000156384. [Q86XK3-1]
ENST00000369729; ENSP00000358744; ENSG00000156384. [Q86XK3-3]
GeneIDi119392.
KEGGihsa:119392.
UCSCiuc001kxs.3. human. [Q86XK3-1]

Organism-specific databases

CTDi119392.
GeneCardsiSFR1.
H-InvDBHIX0009185.
HGNCiHGNC:29574. SFR1.
HPAiHPA039617.
MIMi616527. gene.
neXtProtiNX_Q86XK3.
PharmGKBiPA134989928.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IF5Y. Eukaryota.
ENOG411284F. LUCA.
GeneTreeiENSGT00390000018550.
HOGENOMiHOG000060220.
HOVERGENiHBG056268.
InParanoidiQ86XK3.
OMAiIKKWRSC.
OrthoDBiEOG091G0I3L.
PhylomeDBiQ86XK3.
TreeFamiTF332725.

Miscellaneous databases

GenomeRNAii119392.
PROiQ86XK3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000156384.
CleanExiHS_C10orf78.
GenevisibleiQ86XK3. HS.

Family and domain databases

InterProiIPR018468. Ds-recomb_repair_prot_Mei5.
[Graphical view]
PfamiPF10376. Mei5. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSFR1_HUMAN
AccessioniPrimary (citable) accession number: Q86XK3
Secondary accession number(s): A8K569
, B2RTV8, Q5JT39, Q5JT40, Q8WW47
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: November 2, 2010
Last modified: September 7, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.