Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM131B

Gene

FAM131B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

ReactomeiR-HSA-6802952. Signaling by BRAF and RAF fusions.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM131B
Gene namesi
Name:FAM131B
Synonyms:KIAA0773
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22202. FAM131B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi9715.
OpenTargetsiENSG00000159784.
PharmGKBiPA162386065.

Polymorphism and mutation databases

BioMutaiFAM131B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002530321 – 332Protein FAM131BAdd BLAST332
Isoform 2 (identifier: Q86XD5-2)
Initiator methionineiRemoved

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei47PhosphoserineBy similarity1
Modified residuei114PhosphoserineBy similarity1
Modified residuei117PhosphoserineCombined sources1
Modified residuei295PhosphoserineBy similarity1
Modified residuei297PhosphoserineBy similarity1
Modified residuei313PhosphoserineBy similarity1
Modified residuei316PhosphothreonineBy similarity1
Modified residuei317PhosphoserineBy similarity1
Modified residuei318PhosphoserineBy similarity1
Modified residuei322PhosphoserineBy similarity1
Isoform 2 (identifier: Q86XD5-2)
Lipidationi2N-myristoyl glycine1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiQ86XD5.
PaxDbiQ86XD5.
PeptideAtlasiQ86XD5.
PRIDEiQ86XD5.

PTM databases

iPTMnetiQ86XD5.
PhosphoSitePlusiQ86XD5.
SwissPalmiQ86XD5.

Expressioni

Gene expression databases

BgeeiENSG00000159784.
CleanExiHS_FAM131B.
ExpressionAtlasiQ86XD5. baseline and differential.
GenevisibleiQ86XD5. HS.

Organism-specific databases

HPAiHPA021371.
HPA029992.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-11308812,EBI-717399

Protein-protein interaction databases

BioGridi115064. 31 interactors.
IntActiQ86XD5. 3 interactors.
STRINGi9606.ENSP00000410603.

Structurei

3D structure databases

ProteinModelPortaliQ86XD5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi283 – 286Poly-Glu4

Sequence similaritiesi

Belongs to the FAM131 family.Curated

Phylogenomic databases

eggNOGiENOG410IECV. Eukaryota.
ENOG4111H79. LUCA.
GeneTreeiENSGT00390000015421.
HOVERGENiHBG081012.
InParanoidiQ86XD5.
OMAiSRTVGNE.
OrthoDBiEOG091G090O.
PhylomeDBiQ86XD5.
TreeFamiTF331537.

Family and domain databases

InterProiIPR026782. FAM131.
[Graphical view]
PANTHERiPTHR15736. PTHR15736. 1 hit.
PfamiPF15010. FAM131. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86XD5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSTSSLHGS SLHRPSTEQT RTDFSWDGIN LSMEDTTSIL PKLKRNSNAY
60 70 80 90 100
GIGALAKSSF SGISRSMKDH VTKPTAMGQG RVAHMIEWQG WGKTPAVQPQ
110 120 130 140 150
HSHESVRRDT DAYSDLSDGE KEARFLAGVM EQFAISEATL MAWSSMDGED
160 170 180 190 200
MSVNSTQEPL GCNYSDNYQE LMDSQDALAQ APMDGWPHSY VSQGMYCLGS
210 220 230 240 250
SDAWEASDQS LIASPATGSY LGPAFDDSQP SLHEMGPSQP ASGYSALEPP
260 270 280 290 300
PLLGGDTDWA PGVGAVDLAR GPAEEEKRPL APEEEEDAGC RDLESLSPRE
310 320 330
DPEMSTALSR KVSDVTSSGV QSFDEEEGEA NN
Length:332
Mass (Da):35,769
Last modified:October 17, 2006 - v3
Checksum:i35FE42189855034F
GO
Isoform 2 (identifier: Q86XD5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN → MGCIGSRTVG...GSSLHRPSTE

Show »
Length:348
Mass (Da):37,348
Checksum:i99FDC411A64F5D05
GO
Isoform 3 (identifier: Q86XD5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCIGSRTVGNEVIAVDWKGLKDVDQINM

Note: No experimental confirmation available.
Show »
Length:360
Mass (Da):38,769
Checksum:i31D3278DE4006168
GO

Sequence cautioni

The sequence AAS07501 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47S → F in CAD89938 (PubMed:17974005).Curated1
Sequence conflicti141M → T in CAD89938 (PubMed:17974005).Curated1
Sequence conflicti285E → G in AAH45611 (PubMed:15489334).Curated1
Sequence conflicti291R → Q in AAH45611 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053920307A → T.1 PublicationCorresponds to variant rs17854363dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0416331 – 30MDSTS…WDGIN → MGCIGSRTVGNEVIAVDWKG LKDVDQINMDSTSSLHGSSL HRPSTE in isoform 2. CuratedAdd BLAST30
Alternative sequenceiVSP_0467981M → MGCIGSRTVGNEVIAVDWKG LKDVDQINM in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291470 mRNA. Translation: BAF84159.1.
AL832579 mRNA. Translation: CAD89938.1.
AC093673 Genomic DNA. Translation: AAS07501.1. Sequence problems.
CH236959 Genomic DNA. Translation: EAL23787.1.
CH471198 Genomic DNA. Translation: EAW51853.1.
CH471198 Genomic DNA. Translation: EAW51854.1.
BC045611 mRNA. Translation: AAH45611.2.
BC050543 mRNA. Translation: AAH50543.2.
CCDSiCCDS47734.1. [Q86XD5-3]
CCDS5882.1. [Q86XD5-1]
RefSeqiNP_001026860.2. NM_001031690.2. [Q86XD5-3]
NP_001265226.1. NM_001278297.1.
NP_055505.3. NM_014690.4. [Q86XD5-1]
XP_005250130.1. XM_005250073.3. [Q86XD5-1]
XP_006716249.1. XM_006716186.2.
UniGeneiHs.648908.

Genome annotation databases

EnsembliENST00000409222; ENSP00000387147; ENSG00000159784. [Q86XD5-1]
ENST00000409346; ENSP00000386984; ENSG00000159784. [Q86XD5-1]
ENST00000409408; ENSP00000387017; ENSG00000159784. [Q86XD5-1]
ENST00000409578; ENSP00000386568; ENSG00000159784. [Q86XD5-2]
ENST00000443739; ENSP00000410603; ENSG00000159784. [Q86XD5-3]
GeneIDi9715.
KEGGihsa:9715.
UCSCiuc003wct.4. human. [Q86XD5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291470 mRNA. Translation: BAF84159.1.
AL832579 mRNA. Translation: CAD89938.1.
AC093673 Genomic DNA. Translation: AAS07501.1. Sequence problems.
CH236959 Genomic DNA. Translation: EAL23787.1.
CH471198 Genomic DNA. Translation: EAW51853.1.
CH471198 Genomic DNA. Translation: EAW51854.1.
BC045611 mRNA. Translation: AAH45611.2.
BC050543 mRNA. Translation: AAH50543.2.
CCDSiCCDS47734.1. [Q86XD5-3]
CCDS5882.1. [Q86XD5-1]
RefSeqiNP_001026860.2. NM_001031690.2. [Q86XD5-3]
NP_001265226.1. NM_001278297.1.
NP_055505.3. NM_014690.4. [Q86XD5-1]
XP_005250130.1. XM_005250073.3. [Q86XD5-1]
XP_006716249.1. XM_006716186.2.
UniGeneiHs.648908.

3D structure databases

ProteinModelPortaliQ86XD5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115064. 31 interactors.
IntActiQ86XD5. 3 interactors.
STRINGi9606.ENSP00000410603.

PTM databases

iPTMnetiQ86XD5.
PhosphoSitePlusiQ86XD5.
SwissPalmiQ86XD5.

Polymorphism and mutation databases

BioMutaiFAM131B.

Proteomic databases

MaxQBiQ86XD5.
PaxDbiQ86XD5.
PeptideAtlasiQ86XD5.
PRIDEiQ86XD5.

Protocols and materials databases

DNASUi9715.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409222; ENSP00000387147; ENSG00000159784. [Q86XD5-1]
ENST00000409346; ENSP00000386984; ENSG00000159784. [Q86XD5-1]
ENST00000409408; ENSP00000387017; ENSG00000159784. [Q86XD5-1]
ENST00000409578; ENSP00000386568; ENSG00000159784. [Q86XD5-2]
ENST00000443739; ENSP00000410603; ENSG00000159784. [Q86XD5-3]
GeneIDi9715.
KEGGihsa:9715.
UCSCiuc003wct.4. human. [Q86XD5-1]

Organism-specific databases

CTDi9715.
DisGeNETi9715.
GeneCardsiFAM131B.
H-InvDBHIX0007170.
HGNCiHGNC:22202. FAM131B.
HPAiHPA021371.
HPA029992.
neXtProtiNX_Q86XD5.
OpenTargetsiENSG00000159784.
PharmGKBiPA162386065.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IECV. Eukaryota.
ENOG4111H79. LUCA.
GeneTreeiENSGT00390000015421.
HOVERGENiHBG081012.
InParanoidiQ86XD5.
OMAiSRTVGNE.
OrthoDBiEOG091G090O.
PhylomeDBiQ86XD5.
TreeFamiTF331537.

Enzyme and pathway databases

ReactomeiR-HSA-6802952. Signaling by BRAF and RAF fusions.

Miscellaneous databases

ChiTaRSiFAM131B. human.
GenomeRNAii9715.
PROiQ86XD5.

Gene expression databases

BgeeiENSG00000159784.
CleanExiHS_FAM131B.
ExpressionAtlasiQ86XD5. baseline and differential.
GenevisibleiQ86XD5. HS.

Family and domain databases

InterProiIPR026782. FAM131.
[Graphical view]
PANTHERiPTHR15736. PTHR15736. 1 hit.
PfamiPF15010. FAM131. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiF131B_HUMAN
AccessioniPrimary (citable) accession number: Q86XD5
Secondary accession number(s): A4D2H6
, A6NDW3, A8K605, B8ZZN2, D3DXE3, J3KQX2, Q7L0D6, Q86T97
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 101 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.