Q86XD5 (F131B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 70.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM131B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 332 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Belongs to the FAM131 family. |
| Sequence caution | The sequence AAS07501.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Lipoprotein Myristate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86XD5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86XD5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN → MGCIGSRTVG...GSSLHRPSTE | ||||||
| Note: Myristoylated at Gly-2. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 332 | 332 | Protein FAM131B | PRO_0000253032 | |||||
Regions | |||||||||
| Compositional bias | 283 – 286 | 4 | Poly-Glu | ||||||
Amino acid modifications | |||||||||
| Modified residue | 47 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 114 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 117 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 297 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 322 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 30 | 30 | MDSTS…WDGIN → MGCIGSRTVGNEVIAVDWKG LKDVDQINMDSTSSLHGSSL HRPSTE in isoform 2. | VSP_041633 | |||||
| Natural variant | 307 | 1 | A → T. Ref.6 Corresponds to variant rs17854363 [ dbSNP | Ensembl ]. | VAR_053920 | |||||
Experimental info | |||||||||
| Sequence conflict | 47 | 1 | S → F in CAD89938. Ref.2 | ||||||
| Sequence conflict | 141 | 1 | M → T in CAD89938. Ref.2 | ||||||
| Sequence conflict | 285 | 1 | E → G in AAH45611. Ref.6 | ||||||
| Sequence conflict | 291 | 1 | R → Q in AAH45611. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK291470 mRNA. Translation: BAF84159.1. AL832579 mRNA. Translation: CAD89938.1. AC093673 Genomic DNA. Translation: AAS07501.1. Sequence problems. CH236959 Genomic DNA. Translation: EAL23787.1. CH471198 Genomic DNA. Translation: EAW51853.1. CH471198 Genomic DNA. Translation: EAW51854.1. BC045611 mRNA. Translation: AAH45611.2. BC050543 mRNA. Translation: AAH50543.2. |
| IPI | IPI00641986. IPI00917945. |
| RefSeq | NP_001026860.2. NM_001031690.2. NP_055505.3. NM_014690.4. |
| UniGene | Hs.648908. |
3D structure databases | |
| ProteinModelPortal | Q86XD5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000410603. |
PTM databases | |
| PhosphoSite | Q86XD5. |
Proteomic databases | |
| PaxDb | Q86XD5. |
| PeptideAtlas | Q86XD5. |
| PRIDE | Q86XD5. |
Protocols and materials databases | |
| DNASU | 9715. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000409222; ENSP00000387147; ENSG00000159784. ENST00000409346; ENSP00000386984; ENSG00000159784. ENST00000409408; ENSP00000387017; ENSG00000159784. ENST00000409578; ENSP00000386568; ENSG00000159784. |
| GeneID | 9715. |
| KEGG | hsa:9715. |
| UCSC | uc003wct.3. human. |
Organism-specific databases | |
| CTD | 9715. |
| GeneCards | GC07M143050. |
| H-InvDB | HIX0007170. |
| HGNC | HGNC:22202. FAM131B. |
| HPA | HPA021371. |
| neXtProt | NX_Q86XD5. |
| PharmGKB | PA162386065. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG43720. |
| HOVERGEN | HBG081012. |
| InParanoid | Q86XD5. |
| OrthoDB | EOG4THVT9. |
| PhylomeDB | Q86XD5. |
Gene expression databases | |
| ArrayExpress | Q86XD5. |
| Bgee | Q86XD5. |
| CleanEx | HS_FAM131B. |
| Genevestigator | Q86XD5. |
| GermOnline | ENSG00000159784. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026782. FAM131. [Graphical view] |
| PANTHER | PTHR15736. PTHR15736. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FAM131B. human. |
| GenomeRNAi | 9715. |
| NextBio | 36519. |
Entry information
| Entry name | F131B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86XD5 Secondary accession number(s): A4D2H6 Q86T97 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
