Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86XD5

- F131B_HUMAN

UniProt

Q86XD5 - F131B_HUMAN

Protein

Protein FAM131B

Gene

FAM131B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 3 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM131B
    Gene namesi
    Name:FAM131B
    Synonyms:KIAA0773
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:22202. FAM131B.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162386065.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 332332Protein FAM131BPRO_0000253032Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei117 – 1171Phosphoserine1 Publication
    Modified residuei322 – 3221PhosphoserineBy similarity

    Keywords - PTMi

    Lipoprotein, Myristate, Phosphoprotein

    Proteomic databases

    MaxQBiQ86XD5.
    PaxDbiQ86XD5.
    PeptideAtlasiQ86XD5.
    PRIDEiQ86XD5.

    PTM databases

    PhosphoSiteiQ86XD5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ86XD5.
    BgeeiQ86XD5.
    CleanExiHS_FAM131B.
    GenevestigatoriQ86XD5.

    Organism-specific databases

    HPAiHPA021371.

    Interactioni

    Protein-protein interaction databases

    BioGridi115064. 3 interactions.
    STRINGi9606.ENSP00000410603.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86XD5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi283 – 2864Poly-Glu

    Sequence similaritiesi

    Belongs to the FAM131 family.Curated

    Phylogenomic databases

    eggNOGiNOG43720.
    HOVERGENiHBG081012.
    InParanoidiQ86XD5.
    OMAiQGWGKTP.
    OrthoDBiEOG7Z95MH.
    PhylomeDBiQ86XD5.
    TreeFamiTF331537.

    Family and domain databases

    InterProiIPR026782. FAM131.
    [Graphical view]
    PANTHERiPTHR15736. PTHR15736. 1 hit.
    PfamiPF15010. FAM131. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86XD5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDSTSSLHGS SLHRPSTEQT RTDFSWDGIN LSMEDTTSIL PKLKRNSNAY    50
    GIGALAKSSF SGISRSMKDH VTKPTAMGQG RVAHMIEWQG WGKTPAVQPQ 100
    HSHESVRRDT DAYSDLSDGE KEARFLAGVM EQFAISEATL MAWSSMDGED 150
    MSVNSTQEPL GCNYSDNYQE LMDSQDALAQ APMDGWPHSY VSQGMYCLGS 200
    SDAWEASDQS LIASPATGSY LGPAFDDSQP SLHEMGPSQP ASGYSALEPP 250
    PLLGGDTDWA PGVGAVDLAR GPAEEEKRPL APEEEEDAGC RDLESLSPRE 300
    DPEMSTALSR KVSDVTSSGV QSFDEEEGEA NN 332
    Length:332
    Mass (Da):35,769
    Last modified:October 17, 2006 - v3
    Checksum:i35FE42189855034F
    GO
    Isoform 2 (identifier: Q86XD5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN → MGCIGSRTVG...GSSLHRPSTE

    Note: Initiator Met-1 is removed. Contains a N-myristoyl glycine at position 2.

    Show »
    Length:348
    Mass (Da):37,348
    Checksum:i99FDC411A64F5D05
    GO
    Isoform 3 (identifier: Q86XD5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGCIGSRTVGNEVIAVDWKGLKDVDQINM

    Note: No experimental confirmation available.

    Show »
    Length:360
    Mass (Da):38,769
    Checksum:i31D3278DE4006168
    GO

    Sequence cautioni

    The sequence AAS07501.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti47 – 471S → F in CAD89938. (PubMed:17974005)Curated
    Sequence conflicti141 – 1411M → T in CAD89938. (PubMed:17974005)Curated
    Sequence conflicti285 – 2851E → G in AAH45611. (PubMed:15489334)Curated
    Sequence conflicti291 – 2911R → Q in AAH45611. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti307 – 3071A → T.1 Publication
    Corresponds to variant rs17854363 [ dbSNP | Ensembl ].
    VAR_053920

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3030MDSTS…WDGIN → MGCIGSRTVGNEVIAVDWKG LKDVDQINMDSTSSLHGSSL HRPSTE in isoform 2. CuratedVSP_041633Add
    BLAST
    Alternative sequencei1 – 11M → MGCIGSRTVGNEVIAVDWKG LKDVDQINM in isoform 3. CuratedVSP_046798

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK291470 mRNA. Translation: BAF84159.1.
    AL832579 mRNA. Translation: CAD89938.1.
    AC093673 Genomic DNA. Translation: AAS07501.1. Sequence problems.
    CH236959 Genomic DNA. Translation: EAL23787.1.
    CH471198 Genomic DNA. Translation: EAW51853.1.
    CH471198 Genomic DNA. Translation: EAW51854.1.
    BC045611 mRNA. Translation: AAH45611.2.
    BC050543 mRNA. Translation: AAH50543.2.
    CCDSiCCDS47734.1. [Q86XD5-3]
    CCDS5882.1. [Q86XD5-1]
    RefSeqiNP_001026860.2. NM_001031690.2. [Q86XD5-3]
    NP_001265226.1. NM_001278297.1.
    NP_055505.3. NM_014690.4. [Q86XD5-1]
    XP_005250130.1. XM_005250073.2. [Q86XD5-1]
    XP_006716249.1. XM_006716186.1.
    UniGeneiHs.648908.

    Genome annotation databases

    EnsembliENST00000409222; ENSP00000387147; ENSG00000159784. [Q86XD5-1]
    ENST00000409346; ENSP00000386984; ENSG00000159784. [Q86XD5-1]
    ENST00000409408; ENSP00000387017; ENSG00000159784. [Q86XD5-1]
    ENST00000409578; ENSP00000386568; ENSG00000159784. [Q86XD5-2]
    ENST00000443739; ENSP00000410603; ENSG00000159784. [Q86XD5-3]
    GeneIDi9715.
    KEGGihsa:9715.
    UCSCiuc003wct.3. human. [Q86XD5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK291470 mRNA. Translation: BAF84159.1 .
    AL832579 mRNA. Translation: CAD89938.1 .
    AC093673 Genomic DNA. Translation: AAS07501.1 . Sequence problems.
    CH236959 Genomic DNA. Translation: EAL23787.1 .
    CH471198 Genomic DNA. Translation: EAW51853.1 .
    CH471198 Genomic DNA. Translation: EAW51854.1 .
    BC045611 mRNA. Translation: AAH45611.2 .
    BC050543 mRNA. Translation: AAH50543.2 .
    CCDSi CCDS47734.1. [Q86XD5-3 ]
    CCDS5882.1. [Q86XD5-1 ]
    RefSeqi NP_001026860.2. NM_001031690.2. [Q86XD5-3 ]
    NP_001265226.1. NM_001278297.1.
    NP_055505.3. NM_014690.4. [Q86XD5-1 ]
    XP_005250130.1. XM_005250073.2. [Q86XD5-1 ]
    XP_006716249.1. XM_006716186.1.
    UniGenei Hs.648908.

    3D structure databases

    ProteinModelPortali Q86XD5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115064. 3 interactions.
    STRINGi 9606.ENSP00000410603.

    PTM databases

    PhosphoSitei Q86XD5.

    Proteomic databases

    MaxQBi Q86XD5.
    PaxDbi Q86XD5.
    PeptideAtlasi Q86XD5.
    PRIDEi Q86XD5.

    Protocols and materials databases

    DNASUi 9715.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000409222 ; ENSP00000387147 ; ENSG00000159784 . [Q86XD5-1 ]
    ENST00000409346 ; ENSP00000386984 ; ENSG00000159784 . [Q86XD5-1 ]
    ENST00000409408 ; ENSP00000387017 ; ENSG00000159784 . [Q86XD5-1 ]
    ENST00000409578 ; ENSP00000386568 ; ENSG00000159784 . [Q86XD5-2 ]
    ENST00000443739 ; ENSP00000410603 ; ENSG00000159784 . [Q86XD5-3 ]
    GeneIDi 9715.
    KEGGi hsa:9715.
    UCSCi uc003wct.3. human. [Q86XD5-1 ]

    Organism-specific databases

    CTDi 9715.
    GeneCardsi GC07M143050.
    H-InvDB HIX0007170.
    HGNCi HGNC:22202. FAM131B.
    HPAi HPA021371.
    neXtProti NX_Q86XD5.
    PharmGKBi PA162386065.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG43720.
    HOVERGENi HBG081012.
    InParanoidi Q86XD5.
    OMAi QGWGKTP.
    OrthoDBi EOG7Z95MH.
    PhylomeDBi Q86XD5.
    TreeFami TF331537.

    Miscellaneous databases

    ChiTaRSi FAM131B. human.
    GenomeRNAii 9715.
    NextBioi 35535433.
    PROi Q86XD5.

    Gene expression databases

    ArrayExpressi Q86XD5.
    Bgeei Q86XD5.
    CleanExi HS_FAM131B.
    Genevestigatori Q86XD5.

    Family and domain databases

    InterProi IPR026782. FAM131.
    [Graphical view ]
    PANTHERi PTHR15736. PTHR15736. 1 hit.
    Pfami PF15010. FAM131. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Spinal cord.
    3. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-307.
      Tissue: Brain and Hypothalamus.
    7. "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
      Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
      Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: MYRISTOYLATION AT GLY-2 (ISOFORM 2).
    8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiF131B_HUMAN
    AccessioniPrimary (citable) accession number: Q86XD5
    Secondary accession number(s): A4D2H6
    , A6NDW3, A8K605, B8ZZN2, D3DXE3, J3KQX2, Q7L0D6, Q86T97
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 17, 2006
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 82 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3