Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86XD5

- F131B_HUMAN

UniProt

Q86XD5 - F131B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein FAM131B

Gene

FAM131B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM131B
Gene namesi
Name:FAM131B
Synonyms:KIAA0773
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:22202. FAM131B.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162386065.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 332332Protein FAM131BPRO_0000253032Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei117 – 1171Phosphoserine1 Publication
Modified residuei322 – 3221PhosphoserineBy similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiQ86XD5.
PaxDbiQ86XD5.
PeptideAtlasiQ86XD5.
PRIDEiQ86XD5.

PTM databases

PhosphoSiteiQ86XD5.

Expressioni

Gene expression databases

BgeeiQ86XD5.
CleanExiHS_FAM131B.
ExpressionAtlasiQ86XD5. baseline and differential.
GenevestigatoriQ86XD5.

Organism-specific databases

HPAiHPA021371.

Interactioni

Protein-protein interaction databases

BioGridi115064. 3 interactions.
STRINGi9606.ENSP00000410603.

Structurei

3D structure databases

ProteinModelPortaliQ86XD5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi283 – 2864Poly-Glu

Sequence similaritiesi

Belongs to the FAM131 family.Curated

Phylogenomic databases

eggNOGiNOG43720.
GeneTreeiENSGT00390000015421.
HOVERGENiHBG081012.
InParanoidiQ86XD5.
OMAiQGWGKTP.
OrthoDBiEOG7Z95MH.
PhylomeDBiQ86XD5.
TreeFamiTF331537.

Family and domain databases

InterProiIPR026782. FAM131.
[Graphical view]
PANTHERiPTHR15736. PTHR15736. 1 hit.
PfamiPF15010. FAM131. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86XD5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSTSSLHGS SLHRPSTEQT RTDFSWDGIN LSMEDTTSIL PKLKRNSNAY
60 70 80 90 100
GIGALAKSSF SGISRSMKDH VTKPTAMGQG RVAHMIEWQG WGKTPAVQPQ
110 120 130 140 150
HSHESVRRDT DAYSDLSDGE KEARFLAGVM EQFAISEATL MAWSSMDGED
160 170 180 190 200
MSVNSTQEPL GCNYSDNYQE LMDSQDALAQ APMDGWPHSY VSQGMYCLGS
210 220 230 240 250
SDAWEASDQS LIASPATGSY LGPAFDDSQP SLHEMGPSQP ASGYSALEPP
260 270 280 290 300
PLLGGDTDWA PGVGAVDLAR GPAEEEKRPL APEEEEDAGC RDLESLSPRE
310 320 330
DPEMSTALSR KVSDVTSSGV QSFDEEEGEA NN
Length:332
Mass (Da):35,769
Last modified:October 17, 2006 - v3
Checksum:i35FE42189855034F
GO
Isoform 2 (identifier: Q86XD5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN → MGCIGSRTVG...GSSLHRPSTE

Note: Initiator Met-1 is removed. Contains a N-myristoyl glycine at position 2.

Show »
Length:348
Mass (Da):37,348
Checksum:i99FDC411A64F5D05
GO
Isoform 3 (identifier: Q86XD5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCIGSRTVGNEVIAVDWKGLKDVDQINM

Note: No experimental confirmation available.

Show »
Length:360
Mass (Da):38,769
Checksum:i31D3278DE4006168
GO

Sequence cautioni

The sequence AAS07501.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471S → F in CAD89938. (PubMed:17974005)Curated
Sequence conflicti141 – 1411M → T in CAD89938. (PubMed:17974005)Curated
Sequence conflicti285 – 2851E → G in AAH45611. (PubMed:15489334)Curated
Sequence conflicti291 – 2911R → Q in AAH45611. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti307 – 3071A → T.1 Publication
Corresponds to variant rs17854363 [ dbSNP | Ensembl ].
VAR_053920

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3030MDSTS…WDGIN → MGCIGSRTVGNEVIAVDWKG LKDVDQINMDSTSSLHGSSL HRPSTE in isoform 2. CuratedVSP_041633Add
BLAST
Alternative sequencei1 – 11M → MGCIGSRTVGNEVIAVDWKG LKDVDQINM in isoform 3. CuratedVSP_046798

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291470 mRNA. Translation: BAF84159.1.
AL832579 mRNA. Translation: CAD89938.1.
AC093673 Genomic DNA. Translation: AAS07501.1. Sequence problems.
CH236959 Genomic DNA. Translation: EAL23787.1.
CH471198 Genomic DNA. Translation: EAW51853.1.
CH471198 Genomic DNA. Translation: EAW51854.1.
BC045611 mRNA. Translation: AAH45611.2.
BC050543 mRNA. Translation: AAH50543.2.
CCDSiCCDS47734.1. [Q86XD5-3]
CCDS5882.1. [Q86XD5-1]
RefSeqiNP_001026860.2. NM_001031690.2. [Q86XD5-3]
NP_001265226.1. NM_001278297.1.
NP_055505.3. NM_014690.4. [Q86XD5-1]
XP_005250130.1. XM_005250073.2. [Q86XD5-1]
XP_006716249.1. XM_006716186.1.
UniGeneiHs.648908.

Genome annotation databases

EnsembliENST00000409222; ENSP00000387147; ENSG00000159784. [Q86XD5-1]
ENST00000409346; ENSP00000386984; ENSG00000159784. [Q86XD5-1]
ENST00000409408; ENSP00000387017; ENSG00000159784. [Q86XD5-1]
ENST00000409578; ENSP00000386568; ENSG00000159784. [Q86XD5-2]
ENST00000443739; ENSP00000410603; ENSG00000159784. [Q86XD5-3]
GeneIDi9715.
KEGGihsa:9715.
UCSCiuc003wct.3. human. [Q86XD5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291470 mRNA. Translation: BAF84159.1 .
AL832579 mRNA. Translation: CAD89938.1 .
AC093673 Genomic DNA. Translation: AAS07501.1 . Sequence problems.
CH236959 Genomic DNA. Translation: EAL23787.1 .
CH471198 Genomic DNA. Translation: EAW51853.1 .
CH471198 Genomic DNA. Translation: EAW51854.1 .
BC045611 mRNA. Translation: AAH45611.2 .
BC050543 mRNA. Translation: AAH50543.2 .
CCDSi CCDS47734.1. [Q86XD5-3 ]
CCDS5882.1. [Q86XD5-1 ]
RefSeqi NP_001026860.2. NM_001031690.2. [Q86XD5-3 ]
NP_001265226.1. NM_001278297.1.
NP_055505.3. NM_014690.4. [Q86XD5-1 ]
XP_005250130.1. XM_005250073.2. [Q86XD5-1 ]
XP_006716249.1. XM_006716186.1.
UniGenei Hs.648908.

3D structure databases

ProteinModelPortali Q86XD5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115064. 3 interactions.
STRINGi 9606.ENSP00000410603.

PTM databases

PhosphoSitei Q86XD5.

Proteomic databases

MaxQBi Q86XD5.
PaxDbi Q86XD5.
PeptideAtlasi Q86XD5.
PRIDEi Q86XD5.

Protocols and materials databases

DNASUi 9715.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000409222 ; ENSP00000387147 ; ENSG00000159784 . [Q86XD5-1 ]
ENST00000409346 ; ENSP00000386984 ; ENSG00000159784 . [Q86XD5-1 ]
ENST00000409408 ; ENSP00000387017 ; ENSG00000159784 . [Q86XD5-1 ]
ENST00000409578 ; ENSP00000386568 ; ENSG00000159784 . [Q86XD5-2 ]
ENST00000443739 ; ENSP00000410603 ; ENSG00000159784 . [Q86XD5-3 ]
GeneIDi 9715.
KEGGi hsa:9715.
UCSCi uc003wct.3. human. [Q86XD5-1 ]

Organism-specific databases

CTDi 9715.
GeneCardsi GC07M143050.
H-InvDB HIX0007170.
HGNCi HGNC:22202. FAM131B.
HPAi HPA021371.
neXtProti NX_Q86XD5.
PharmGKBi PA162386065.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG43720.
GeneTreei ENSGT00390000015421.
HOVERGENi HBG081012.
InParanoidi Q86XD5.
OMAi QGWGKTP.
OrthoDBi EOG7Z95MH.
PhylomeDBi Q86XD5.
TreeFami TF331537.

Miscellaneous databases

ChiTaRSi FAM131B. human.
GenomeRNAii 9715.
NextBioi 35535433.
PROi Q86XD5.

Gene expression databases

Bgeei Q86XD5.
CleanExi HS_FAM131B.
ExpressionAtlasi Q86XD5. baseline and differential.
Genevestigatori Q86XD5.

Family and domain databases

InterProi IPR026782. FAM131.
[Graphical view ]
PANTHERi PTHR15736. PTHR15736. 1 hit.
Pfami PF15010. FAM131. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Spinal cord.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-307.
    Tissue: Brain and Hypothalamus.
  7. "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
    Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
    Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: MYRISTOYLATION AT GLY-2 (ISOFORM 2).
  8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiF131B_HUMAN
AccessioniPrimary (citable) accession number: Q86XD5
Secondary accession number(s): A4D2H6
, A6NDW3, A8K605, B8ZZN2, D3DXE3, J3KQX2, Q7L0D6, Q86T97
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: October 29, 2014
This is version 83 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3