Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

COMM domain-containing protein 2

Gene

COMMD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966).1 Publication1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation, Ubl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
COMM domain-containing protein 2
Gene namesi
Name:COMMD2
ORF Names:HSPC042, My004
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:24993. COMMD2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000114744.
PharmGKBiPA134923363.

Polymorphism and mutation databases

BioMutaiCOMMD2.
DMDMi116241310.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000773861 – 199COMM domain-containing protein 2Add BLAST199

Proteomic databases

EPDiQ86X83.
MaxQBiQ86X83.
PaxDbiQ86X83.
PeptideAtlasiQ86X83.
PRIDEiQ86X83.
TopDownProteomicsiQ86X83-1. [Q86X83-1]

PTM databases

iPTMnetiQ86X83.
PhosphoSitePlusiQ86X83.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000114744.
CleanExiHS_COMMD2.
ExpressionAtlasiQ86X83. baseline and differential.
GenevisibleiQ86X83. HS.

Organism-specific databases

HPAiHPA044190.

Interactioni

Subunit structurei

Interacts (via COMM domain) with COMMD1 (via COMM domain). Interacts with RELA, RELB, NFKB1/p105, NFKB2/p100. Interacts with CCDC22, CCDC93, SCNN1B, CUL3, CUL4B, CUL5, CUL7.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC22O608265EBI-1550220,EBI-3943153

Protein-protein interaction databases

BioGridi119309. 37 interactors.
IntActiQ86X83. 14 interactors.
STRINGi9606.ENSP00000419475.

Structurei

3D structure databases

ProteinModelPortaliQ86X83.
SMRiQ86X83.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini123 – 190COMMPROSITE-ProRule annotationAdd BLAST68

Sequence similaritiesi

Contains 1 COMM domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IKFK. Eukaryota.
ENOG410XTIB. LUCA.
GeneTreeiENSGT00390000008489.
HOGENOMiHOG000008688.
HOVERGENiHBG060564.
InParanoidiQ86X83.
OMAiQEDERLH.
OrthoDBiEOG091G0UUT.
PhylomeDBiQ86X83.
TreeFamiTF323519.

Family and domain databases

InterProiIPR017920. COMM.
[Graphical view]
PfamiPF07258. COMM_domain. 1 hit.
[Graphical view]
PROSITEiPS51269. COMM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86X83-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLELSEEHK EHLAFLPQVD SAVVAEFGRI AVEFLRRGAN PKIYEGAARK
60 70 80 90 100
LNVSSDTVQH GVEGLTYLLT ESSKLMISEL DFQDSVFVLG FSEELNKLLL
110 120 130 140 150
QLYLDNRKEI RTILSELAPS LPSYHNLEWR LDVQLASRSL RQQIKPAVTI
160 170 180 190
KLHLNQNGDH NTKVLQTDPA TLLHLVQQLE QALEEMKTNH CRRVVRNIK
Length:199
Mass (Da):22,745
Last modified:October 17, 2006 - v2
Checksum:iECB4B7C26FCEA0F2
GO
Isoform 2 (identifier: Q86X83-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-199: QTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK → GLQA

Note: No experimental confirmation available.
Show »
Length:169
Mass (Da):19,119
Checksum:i74D334791D912BE5
GO

Sequence cautioni

The sequence AAD39913 differs from that shown. Reason: Frameshift at positions 111, 160, 174 and 188.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti199K → Q in AAD39913 (PubMed:11042152).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028010113I → L.3 PublicationsCorresponds to variant rs9843784dbSNPEnsembl.1
Natural variantiVAR_028011177Q → H.Corresponds to variant rs1546732dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055533166 – 199QTDPA…VRNIK → GLQA in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY542158 mRNA. Translation: AAS22240.1.
AF059618 mRNA. Translation: AAG43117.1.
AF125096 mRNA. Translation: AAD39913.1. Frameshift.
BC046131 mRNA. Translation: AAH46131.1.
BC093077 mRNA. Translation: AAH93077.1.
CCDSiCCDS3145.1. [Q86X83-1]
RefSeqiNP_057178.2. NM_016094.3. [Q86X83-1]
UniGeneiHs.432729.

Genome annotation databases

EnsembliENST00000473414; ENSP00000419475; ENSG00000114744. [Q86X83-1]
GeneIDi51122.
KEGGihsa:51122.
UCSCiuc003exj.2. human. [Q86X83-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY542158 mRNA. Translation: AAS22240.1.
AF059618 mRNA. Translation: AAG43117.1.
AF125096 mRNA. Translation: AAD39913.1. Frameshift.
BC046131 mRNA. Translation: AAH46131.1.
BC093077 mRNA. Translation: AAH93077.1.
CCDSiCCDS3145.1. [Q86X83-1]
RefSeqiNP_057178.2. NM_016094.3. [Q86X83-1]
UniGeneiHs.432729.

3D structure databases

ProteinModelPortaliQ86X83.
SMRiQ86X83.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119309. 37 interactors.
IntActiQ86X83. 14 interactors.
STRINGi9606.ENSP00000419475.

PTM databases

iPTMnetiQ86X83.
PhosphoSitePlusiQ86X83.

Polymorphism and mutation databases

BioMutaiCOMMD2.
DMDMi116241310.

Proteomic databases

EPDiQ86X83.
MaxQBiQ86X83.
PaxDbiQ86X83.
PeptideAtlasiQ86X83.
PRIDEiQ86X83.
TopDownProteomicsiQ86X83-1. [Q86X83-1]

Protocols and materials databases

DNASUi51122.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000473414; ENSP00000419475; ENSG00000114744. [Q86X83-1]
GeneIDi51122.
KEGGihsa:51122.
UCSCiuc003exj.2. human. [Q86X83-1]

Organism-specific databases

CTDi51122.
GeneCardsiCOMMD2.
HGNCiHGNC:24993. COMMD2.
HPAiHPA044190.
MIMi616699. gene.
neXtProtiNX_Q86X83.
OpenTargetsiENSG00000114744.
PharmGKBiPA134923363.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKFK. Eukaryota.
ENOG410XTIB. LUCA.
GeneTreeiENSGT00390000008489.
HOGENOMiHOG000008688.
HOVERGENiHBG060564.
InParanoidiQ86X83.
OMAiQEDERLH.
OrthoDBiEOG091G0UUT.
PhylomeDBiQ86X83.
TreeFamiTF323519.

Miscellaneous databases

ChiTaRSiCOMMD2. human.
GenomeRNAii51122.
PROiQ86X83.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114744.
CleanExiHS_COMMD2.
ExpressionAtlasiQ86X83. baseline and differential.
GenevisibleiQ86X83. HS.

Family and domain databases

InterProiIPR017920. COMM.
[Graphical view]
PfamiPF07258. COMM_domain. 1 hit.
[Graphical view]
PROSITEiPS51269. COMM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCOMD2_HUMAN
AccessioniPrimary (citable) accession number: Q86X83
Secondary accession number(s): Q561V4, Q9H3L5, Q9Y5V1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 17, 2006
Last modified: November 2, 2016
This is version 110 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.