Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

COMM domain-containing protein 2

Gene

COMMD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966).1 Publication1 Publication

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation

Names & Taxonomyi

Protein namesi
Recommended name:
COMM domain-containing protein 2
Gene namesi
Name:COMMD2
ORF Names:HSPC042, My004
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114744.8
HGNCiHGNC:24993 COMMD2
MIMi616699 gene
neXtProtiNX_Q86X83

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000114744
PharmGKBiPA134923363

Polymorphism and mutation databases

BioMutaiCOMMD2
DMDMi116241310

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000773861 – 199COMM domain-containing protein 2Add BLAST199

Proteomic databases

EPDiQ86X83
MaxQBiQ86X83
PaxDbiQ86X83
PeptideAtlasiQ86X83
PRIDEiQ86X83
TopDownProteomicsiQ86X83-1 [Q86X83-1]

PTM databases

iPTMnetiQ86X83
PhosphoSitePlusiQ86X83

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000114744
CleanExiHS_COMMD2
ExpressionAtlasiQ86X83 baseline and differential
GenevisibleiQ86X83 HS

Organism-specific databases

HPAiHPA044190

Interactioni

Subunit structurei

Interacts (via COMM domain) with COMMD1 (via COMM domain). Interacts with RELA, RELB, NFKB1/p105, NFKB2/p100. Interacts with CCDC22, CCDC93, SCNN1B, CUL3, CUL4B, CUL5, CUL7.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC22O608265EBI-1550220,EBI-3943153

Protein-protein interaction databases

BioGridi119309, 40 interactors
CORUMiQ86X83
IntActiQ86X83, 14 interactors
STRINGi9606.ENSP00000419475

Structurei

3D structure databases

ProteinModelPortaliQ86X83
SMRiQ86X83
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini123 – 190COMMPROSITE-ProRule annotationAdd BLAST68

Phylogenomic databases

eggNOGiENOG410IKFK Eukaryota
ENOG410XTIB LUCA
GeneTreeiENSGT00390000008489
HOGENOMiHOG000008688
HOVERGENiHBG060564
InParanoidiQ86X83
KOiK22558
OMAiQEDERLH
OrthoDBiEOG091G0UUT
PhylomeDBiQ86X83
TreeFamiTF323519

Family and domain databases

CDDicd04750 Commd2, 1 hit
InterProiView protein in InterPro
IPR017920 COMM
IPR037354 Commd2
PANTHERiPTHR15857 PTHR15857, 1 hit
PfamiView protein in Pfam
PF07258 COMM_domain, 1 hit
PROSITEiView protein in PROSITE
PS51269 COMM, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86X83-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLELSEEHK EHLAFLPQVD SAVVAEFGRI AVEFLRRGAN PKIYEGAARK
60 70 80 90 100
LNVSSDTVQH GVEGLTYLLT ESSKLMISEL DFQDSVFVLG FSEELNKLLL
110 120 130 140 150
QLYLDNRKEI RTILSELAPS LPSYHNLEWR LDVQLASRSL RQQIKPAVTI
160 170 180 190
KLHLNQNGDH NTKVLQTDPA TLLHLVQQLE QALEEMKTNH CRRVVRNIK
Length:199
Mass (Da):22,745
Last modified:October 17, 2006 - v2
Checksum:iECB4B7C26FCEA0F2
GO
Isoform 2 (identifier: Q86X83-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-199: QTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK → GLQA

Note: No experimental confirmation available.
Show »
Length:169
Mass (Da):19,119
Checksum:i74D334791D912BE5
GO

Sequence cautioni

The sequence AAD39913 differs from that shown. Reason: Frameshift at positions 111, 160, 174 and 188.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti199K → Q in AAD39913 (PubMed:11042152).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028010113I → L3 PublicationsCorresponds to variant dbSNP:rs9843784Ensembl.1
Natural variantiVAR_028011177Q → H. Corresponds to variant dbSNP:rs1546732Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055533166 – 199QTDPA…VRNIK → GLQA in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY542158 mRNA Translation: AAS22240.1
AF059618 mRNA Translation: AAG43117.1
AF125096 mRNA Translation: AAD39913.1 Frameshift.
BC046131 mRNA Translation: AAH46131.1
BC093077 mRNA Translation: AAH93077.1
CCDSiCCDS3145.1 [Q86X83-1]
RefSeqiNP_057178.2, NM_016094.3 [Q86X83-1]
UniGeneiHs.432729

Genome annotation databases

EnsembliENST00000473414; ENSP00000419475; ENSG00000114744 [Q86X83-1]
GeneIDi51122
KEGGihsa:51122
UCSCiuc003exj.2 human [Q86X83-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCOMD2_HUMAN
AccessioniPrimary (citable) accession number: Q86X83
Secondary accession number(s): Q561V4, Q9H3L5, Q9Y5V1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 17, 2006
Last modified: May 23, 2018
This is version 118 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health